KEGG   Rattus norvegicus (rat): 360652Help
Entry
360652            CDS       T01003                                 

Gene name
Sdk2
Definition
(RefSeq) sidekick cell adhesion molecule 2
  KO
K16353  protein sidekick
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rno04515]
    360652 (Sdk2)
Cell adhesion molecules [BR:rno04515]
 Immunoglobulin superfamily
  Sidekick 1/2
   360652 (Sdk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 I-set Ig_3 Ig_2 Pur_ac_phosph_N ig V-set C2-set_2 Interfer-bind Ig_6 Ig_C17orf99
Motif
Other DBs
NCBI-GeneID: 360652
NCBI-ProteinID: NP_001101773
RGD: 1310397
Ensembl: ENSRNOG00000024711
UniProt: D3ZDA6
Position
10q32.1
AA seq 2053 aa AA seqDB search
MGALLQRQTEVQVAYMGSFEEGEKHQSVSHGEAAVIKAPRISSFPRPQVTWFRDGRKIPP
SSRIAITLENTLVILSTVAPDAGRYYVQAVNDKNGDNKTSQPITLAVENVGGPADPIAPT
IIIPPKNTSVVAGTSEVTMECVANARPLIKLHIVWKKDGALLSNGISDYNRRLTITNPMV
SDAGYYECEAMLRSSSVAPVTRGAYLSVLEPPQFVREPERHITAEMEKVVDIPCRAKGVP
PPSITWYKDAALVEVGKLTRFKQRSDGGLQISGLLPDDTGMVQCFAHNAAGEAQTSTYLA
VTSIAPNITRGPLDSTVIDGMSVVLACETSGAPRPAITWQKGERILASGSVQLPRFTLLE
SGSLLISPTHISDAGTYTCLATNSRGVDEASADLVVWARTRITKPPQDQSVIKGTQASMV
CGVTHDPRVTVRYVWEKDGATLAVETNPRIRLDRNGSLHISQTWSGDIGTYTCRVLSAGG
NDSRNAHLRVRQLPHAPEHPVATLSTMERRAINLTWAKPFDGNSPLMRYILEMSENNAPW
TILLASVDPEATSVMVKGLVPARSYQFRLCAVNDVGKGQFSKDTERVSLPEEPPTAPPQN
VIASGRTNQSIMIQWQPPPESHQNGILKGYIIRYCLAGLPVGYQFKNITDADVNNLLLED
LIIWTNYEIEVAAYNSAGLGVYSSKVTEWTLQGVPTVPPGNVHAEATNSTAIRFTWNAPS
PQFINGINQGYKLIAWEPTQEEEVTMVTARPNFQDSIHVGFVSGLKKFTEYFTSVLCFTT
PGDGPRSSPQLVRTHEDVPGPVGHLSFNDILDTSLKVSWQEPGEKNGILTGYRISWEEYN
RTNTRVTHYLPNVTLEYRVTGLTALTTYTIEVAAMTSKGQGQVSASTISSGVPPELPGAP
TNLGISNIGPRSVTLQFRPGYDGKTSISRWVVEAQVGMIGEGEEWLLIYQLSNEPDARSM
EVPDLNPFTYYSFRMRQVNIVGTSPPSQPSRKIQTLQAPPDMAPANVTLRTASETSLWLR
WMPLPEMEYNGNPESVGYKIKYSRSDGHGKTLSHTVQDRVEREYTIEDLEEWTEYRVQVQ
AFNAIGSGPWSQAVVGRTRESVPSSGPTNVSALATTSSSMLVRWSEIPEADRNGLVLGYK
VRYKEKDSDSQARFWLVEGNSSRSAQLTGLGKYVLYEVQVLAFTRIGDGSPSHPPILERT
LDDVPGPPMGILFPEVRTTSVRLIWQPPATPNGIILAYQITHRLNATTANTATVEVLAPS
ARQYMATGLKPESVYLFRITAQTRKGWGEAAEALVVTTEKRDRPQPPSKPVVQQEDVKAR
SVLLSWEPGSDGLSPVRYYTIQTRELPSGRWALHSASVSHNASAFTVDRLKPFTSYKFRV
KATNDIGDSEFSEESESLTTLQAAPDEAPTILSVTPHTTTSVLIRWQPPSEDKINGILLG
FRIRYRELLYEGLRGFTLRGINNPGAKWAELTYLTKHRRYEIRMSVYNAVGEGPLSPPQE
VFVGEAVPTAAPQNVAIHSATATQLDVTWEPPPLDNQNGDIQGYKIYFWEVQRRNLTERV
KTLFLAENSVKLKNLTGYTAYMVSVAAFNAAGDGPRSTPTQGQTQQAAPSAPGSVKFSEL
TTTSVNVSWDAPQFPNGPLEGYRLVYEPCTPVDGVSKIVTVDVKGNSPLWLKVKDLAEGM
TYRFRIKAKTFTYGPEIEANITTGPGEGAPGPPGVPIIVRYSSAIAIHWSSGDPGKGPIT
RYVIEARPSDEGLWDILIKDIPKEVTSYTFSMDILKPGVSYDFRVIAVNDYGFGTPSSPS
QSVPAQKASPFYEEWWFLVVIALVGLIFILLLVFVLIIRGQSKKYSKKTDAGGNTKSGAL
GHGEMLSLDESSFPALELNNRRLSVKNSFCRKNGLYTRPSPGSLHYSDEDVTKYNDLIPA
ESSSLTEKPSEISDSQGSDSEYEVDTNTQKAHSFVNHYISDPTYYNSWRRQQKGISRAQA
YSYTESDSGEPDHVTVPNSNSTQQGSLFRPKASRTPTPQNPPNPPSQQSTLYRPPSSLAP
GSRAPIAGFSSFV
NT seq 6162 nt NT seq  +upstreamnt  +downstreamnt
atgggggccctgctacagcggcagactgaggtccaggtggcttacatggggagtttcgag
gaaggcgagaaacaccagagcgtgtcccacggagaagctgctgtcatcaaagcaccacgc
atttccagcttcccccggccacaggtgacctggttccgtgacggacgcaagatcccgccc
agcagccggatagccatcacgctggagaacaccctggtcatcctgtccacggtggctcct
gatgctggccgctactacgtgcaggcagttaatgacaagaacggagacaacaagaccagc
cagcccatcactctcgctgtggagaatgtcggggggccggctgaccccatcgcaccgacc
atcatcatcccacccaagaacaccagtgttgtggctgggacctccgaggtgaccatggag
tgtgtggccaacgccaggcccctgatcaagctgcacattgtgtggaagaaagacggggct
ctgctctccaatggcatcagcgactacaaccgcaggctcaccatcaccaaccccatggtc
agcgatgccggctactatgagtgcgaagccatgctacgcagcagcagcgtggcccctgtc
acccggggcgcctacctctccgtgctggagccacctcagtttgtcagagagcctgagaga
cacatcacagccgagatggagaaggtggtggacatcccctgtcgagccaaaggggtgccg
cctccctccatcacctggtacaaggacgccgcgttggtggaggtggggaagctgacacgc
ttcaagcagcgcagcgacggtggcctgcagatcagcggcctgctgcccgatgacaccggc
atggtccagtgctttgcccacaatgcagctggcgaggcccagacctccacctacctggct
gtcaccagcatcgcccctaacatcaccagaggccccctcgacagcacggtgattgacggc
atgtcagtggtactggcgtgtgagacctcaggggcaccacggcctgctatcacttggcag
aaaggggagcgaatcttagccagtggctctgtccagctgcccagattcacgctgctggag
tctggcagcctactcattagcccaacccatatctcggacgccggtacctacacctgtctg
gccaccaactctcggggagtagacgaggcctctgcagacctggtcgtatgggcccggaca
cgcatcaccaaacccccgcaggaccagagtgtcatcaagggcacccaggcctccatggtg
tgtggagtgacccacgatcccagagtgactgtcaggtatgtgtgggagaaggatggggcc
accctggccgtggagactaatcctcggatccgcctggacagaaatggctccctacacatc
tcgcagacatggtcaggggacattggcacgtatacctgccgggtactctcagctggtggc
aatgactctcgcaacgcccacctgcgagtcaggcagctcccccatgctcctgagcacccc
gtggcaacactcagcaccatggagagacgcgccatcaacctgacctgggctaaacccttc
gacggcaacagccctctgatgcgctacatcttggagatgtcggaaaacaatgctccctgg
accatacttctggccagcgtggacccagaagccacctccgtgatggtcaagggactggtt
cccgctcgttcttaccagttccgcctctgcgctgtcaacgatgtgggcaaaggacaattc
agcaaggacacagaaagggtctcccttcctgaggagccccccaccgctcctccacagaac
gtcattgccagcggccggaccaaccaatccatcatgatccagtggcaaccacctcctgag
agccaccagaacgggattctcaagggctacatcatcagatattgcctggcgggactccct
gttgggtaccagtttaagaacatcacagacgccgacgtcaacaacctgctgctggaggac
ctcatcatttggaccaattatgagatcgaggtggctgcctacaacagcgccgggctggga
gtctacagcagcaaagtcaccgagtggacactgcagggagttcccacggtgccccctggc
aacgtgcacgcagaggccacaaattctacggccatccgcttcacctggaacgcccccagc
ccccagttcatcaacggcatcaaccagggctacaagctgattgcctgggagccaacccaa
gaggaggaggttaccatggtgaccgccaggcccaactttcaagacagcatccacgtgggc
ttcgtgtctggcctgaaaaaattcacagagtacttcacatcggtgctatgcttcaccaca
ccgggagacgggcctcgaagcagccctcagctggtgcgcacccatgaggacgtgcctggg
cccgtgggacacctgagcttcaatgacatcctggacacctcactgaaggtcagctggcag
gagcctggagagaagaatggtatcctgacagggtaccggatctcctgggaagagtacaac
agaaccaatacccgtgtgacccactacctgcccaacgtaaccctggagtaccgagtcaca
ggcctcacagcacttactacctatactatcgaggtggccgctatgacctccaagggccag
ggccaggtgtcagcctctaccatttcatctggtgtgcctccagagcttccaggggcaccc
accaacctgggcatttccaacattggcccacgatccgtgaccttgcagttcaggcctggc
tatgatgggaagacatccatctcccgctgggtagtggaggctcaggtgggcatgatcggg
gagggagaggagtggttgctcatctaccaactcagcaatgagcctgacgcacgctccatg
gaggtgccggacctcaaccccttcacctactacagcttccgcatgcgccaagtgaacatt
gtcggcaccagcccacccagtcaaccttctagaaagatccagaccctccaggcaccccca
gacatggccccagccaacgtgaccctgcgtacagccagtgagaccagcttgtggctccgg
tggatgcccctcccagaaatggaatacaacggcaaccctgagtcagtgggctacaagatc
aagtacagccggtctgacggccacggcaagacactgagccacacggtacaagaccgagtg
gagcgagaatacacgattgaggacctggaggagtggacagagtaccgtgtccaggtccag
gccttcaacgccatcgggagcgggccctggagccaggcggtggtgggcaggacccgggag
tcagtcccatcctctggccccaccaacgtgtcagctctggccaccacctctagtagcatg
ctggttcgatggagcgagatcccggaagcagatcgaaatggcctcgtgctgggctacaag
gtgaggtacaaggagaaggactcggactcccaggcccggttctggctggtagaagggaac
tcgtcccgcagcgcccagctcacaggcctgggcaagtacgtgctctacgaggtccaggtt
ctggccttcacacgcatcggcgacggcagccccagccaccctcccatcctggagcggacg
ctagatgatgtcccgggaccccccatgggcatcctgtttccagaggtgagaaccacatct
gtgcggctcatctggcagccccccgcaacccccaacggcatcattctggcctaccagatc
acacaccggctcaacgccactacagccaacaccgccacagtggaggtcctggcacccagt
gcccgccagtacatggccacgggcctcaagccggagtctgtctacctattccgtatcaca
gcccaaacccgaaaaggctggggagaggctgctgaggccttggtggtgactacagagaag
agagaccgcccgcagccccctagcaagccggtggtacagcaggaagatgtgaaagcacgc
agcgtgctgctgtcctgggagccaggcagcgacgggctctccccagtccgctactacacc
atccagactcgcgaactgcccagcggcaggtgggcgctgcactccgcctcagtgagccac
aacgcctccgccttcactgtggacagactcaaaccctttacgtcctacaagttccgagtg
aaggctaccaatgacatcggggacagcgagttcagcgaggaatcagagtcgctgaccacc
ctgcaggcagcccccgatgaggcacccaccatcctgtcggtgactccccacaccaccacc
tctgtgctaatccgatggcagcctccatccgaggacaagatcaacggcatcctcttgggc
ttccgaatccggtaccgggagctgctctacgaagggctgagaggcttcactcttcggggc
atcaacaaccctggggccaagtgggctgagctcacctatctgaccaagcacaggcgttac
gagatccgaatgagtgtgtacaacgccgtgggcgagggacccttgagcccgccgcaagag
gtctttgtcggggaggcagtgcccacggcagcaccacagaacgtggccatccacagtgcc
acggccacacagctggatgtgacctgggagccgcccccattggacaaccagaatggagac
atccaaggatacaagatttatttctgggaagtccagcggaggaacctcacggagagggtg
aagactctcttcctggctgagaacagcgtgaaactcaagaacctgactggttacacggcc
tacatggtcagcgtggcagccttcaatgctgcgggggatgggccacggagcaccccgacc
cagggccagactcagcaagcagcccccagtgccccaggctcagtcaagttcagcgagctg
accactacctcagtgaatgtgtcctgggacgccccacagttccccaacggtcctctggag
ggctacaggctggtgtatgaaccctgcaccccagtggatggggtcagcaagattgtgaca
gtggacgtgaaggggaacagtccactgtggctaaaagtgaaggatctggccgagggcatg
acctatcgtttccgaatcaaagccaagaccttcacctacgggcctgagattgaagctaac
atcactacgggccctggagaaggtgcaccaggaccaccaggagtaccaatcattgttcgg
tacagctcggccattgccatccactggtccagcggagatcctggcaaaggacccatcaca
cgctatgtaatagaggccaggccttcagatgaggggctctgggatatcctcatcaaggat
atccccaaggaggtgacttcctataccttcagcatggacatcctgaagccaggcgtaagc
tacgacttccgggtcatcgcagtcaatgactacggctttggcactcccagcagcccctcc
cagtctgtaccagcccagaaagccagccccttttatgaggaatggtggttcttggtggtc
attgcccttgtgggtctcatcttcatcctgctcctggtcttcgtactcatcatccgaggt
cagagcaagaagtattccaagaagacagatgcaggtgggaataccaagtcaggagcactc
ggccatggggagatgctaagcttggatgaaagcagttttcctgctctggaactcaacaac
cggcggctgtctgtgaagaactccttctgcaggaagaatggcttgtacaccaggcccagt
ccaggcagcctacattactctgatgaagatgtcaccaaatacaatgacctcatcccggca
gagagcagcagcctgacagagaagccctcggagatctctgactcccaggggagtgacagc
gagtacgaagtggacacgaacacccagaaagcccactccttcgtcaaccattacatcagt
gaccccacatattacaactcttggcggcgccaacagaaaggcatctctcgggcccaggct
tacagctacacagagagcgattccggcgaacctgaccacgtcactgtccccaacagcaac
agcacccagcaaggcagccttttccggcccaaggccagccggactccaacgccccaaaac
cccccaaatcccccgagtcagcagagcaccctctaccgtccccccagcagcctcgccccc
ggctcccgggcacccatagctgggttctcatccttcgtttga

DBGET integrated database retrieval system