KEGG   Rattus norvegicus (rat): 360659
Entry
360659            CDS       T01003                                 

Gene name
Mif4gd, RGD1309685
Definition
(RefSeq) MIF4G domain containing
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: MIF4G
Other DBs
NCBI-GeneID: 360659
NCBI-ProteinID: NP_001014144
RGD: 1309685
Ensembl: ENSRNOG00000003837
UniProt: Q6AXU7
Position
10q32.1
AA seq 222 aa
MGEASRDEYKIQSFDAETQQLLKTALKDPGAVDLERVANVIVDHSLQDCVFSKEAGRMCY
AIIQAESKQAGQSVFRRGLLNRLQKEYDAREQLRACSLQGWVCYVTFICNIFDYLRVNNM
PMMALVNPVYDCLFQLAQPESLSREEEVDCLVLQLHRVGEQLEKMNGQRMDELFILIRDG
FLLPIDLSSLARLLLLEIIEFRAAGWKTTPAAHKYYYSEVSD
NT seq 669 nt   +upstreamnt  +downstreamnt
atgggcgaggccagcagagatgagtataaaatccagtctttcgatgcagagactcagcag
ctgctgaagactgcactcaaagatccaggtgctgtggacctggagagagtagccaacgtg
attgtggaccattctctgcaggactgcgtattcagcaaggaagcaggacggatgtgctac
gccattattcaggcagagagtaagcaagcaggccagagcgtcttccgccgtgggctcctc
aaccggctgcagaaggagtacgatgcccgggagcagcttcgagcatgctccctgcagggc
tgggtctgctatgtcacctttatctgcaacatctttgactacctgagggtgaacaacatg
cccatgatggccctggttaaccctgtctatgactgtctcttccagctggcccagcctgag
agtctgagcagggaagaggaggtggactgcctggtgctgcagctgcaccgggttggggag
cagctggagaagatgaatgggcagcgcatggatgagctctttatcctaatccgggatggc
ttcctgctccccatagacctcagctccctggcccggttgctgctgctggagatcattgag
ttccgggcagctggctggaagaccacgcctgccgctcataagtattactacagtgaggtg
tctgactaa

DBGET integrated database retrieval system