KEGG   Rattus norvegicus (rat): 360672Help
Entry
360672            CDS       T01003                                 

Gene name
Cep131, Azi1
Definition
(RefSeq) centrosomal protein 131
  KO
K16540  5-azacytidine-induced protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    360672 (Cep131)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Other PCM proteins
     360672 (Cep131)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IQ
Motif
Other DBs
NCBI-GeneID: 360672
NCBI-ProteinID: NP_001101780
RGD: 1307745
Ensembl: ENSRNOG00000004430
UniProt: D4AEL8
Position
10q32.3
AA seq 1069 aa AA seqDB search
MKGSRTISATPEGSPEGMDLSLIGLPLPMSQRPGSASAAKSIFRSVSVATGSEPRKKALE
ATGPGGPRAINNLRRSNSTTQVNQSWTGSPRPAEPTDFLMLFEGSTSGRRRVASFSKVSS
EKGATWNVLDDQPRDFASPANSQSPSTLDSALGPRRKECSLAPSFTANNRSNKGAVGNCV
TTMVHNHYASSKKVSPPKSSNQTAPSLNNIVKAAAREGGEGSDFGKPRKNFSSVSQSTRG
TTGLLRRKEVTEEEAERFIQQVNQAAVTIQRWYRCQVQRRRTGAASLEHLLASKREGQRQ
RLGSGNLLDLHRQEEAARKKAREEKARQARQAAIQELQQKRAQKAREVEHRPPKERPETR
ALEQPRPTQEPPSMPSSVTHPKANNAGASLYPTGPADPCPPASESFPERQPSLEDKPQDA
HSQVEAREDLAALASTRSKTRARATLDDLLDTLKLLEEEPEPLLHPKAYRQDRYAWMDEE
EDTNPLTADNLEKFGKLSAAPGPPDDGTLLSEAKLQSIMTFLDEMEKSGQERPAPWRESL
VLEAGPRSLELGSEGTTSVMRLKLELEEKKQAMVLLQRALAQQRDLATRRVKETEKELSR
QLRQQKEQYEATIQRHLSFIDQLIEDKKVLSEKCEAVVAELKQGDQRCRERVAQVQEQHE
LEIKKLKELMSATEKIRREKWINEKTKKIKEITVRGLEPEIQKLIAKHKQEVRRLRGLHE
AELQQREEQAAQRHLRQAEELREHLEREREALGQQERERAQQRLEQHLEQEQRALEQQRR
RLYTEVAEEKERLGQQAARQRVELEELRQQLEESSAALTRALRAEFERSREEQERRHQME
LKALKDQLEAERQAWVASCAKKEEAWLLTRERELKEEIRKGRDQEIELVIHRLEADMTLA
KEESERAAENRVKRVRDKYETELSELEQSERKLQERCTELKGRLGEAEGEKERLQSLLRQ
KEKELDDLRVVNTQMCSERASLAQVVRQEFAEQLAASQEETQRVKAELAELRARQQMELD
EVHRRVKTALARKEAAVNSLRKQHEAAEKRADHLEELLEQHKGPSLSSK
NT seq 3210 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggttcacggaccatcagtgccactcccgaaggcagtccagaaggtatggacttg
agtctgattggcctccctctacccatgtcccagcggcccggcagtgcctctgccgcaaag
tctattttccgctccgtgtctgtggccacaggcagtgagccgagaaaaaaggcactggag
gccactgggcctgggggcccccgagctatcaacaatcttcgaagatccaacagtactacg
caggtcaaccagtcatggaccggctcccccaggccagcagagcccaccgacttcctaatg
ctctttgagggtagcaccagtgggagaagaagggtggccagctttagcaaggtgtccagc
gagaagggagccacgtggaatgtcttggatgaccagcctagggactttgcttcaccagcc
aacagtcagagtcccagcacccttgactctgccttgggcccacggaggaaggagtgttcc
ctagcgcccagcttcactgctaacaacaggagcaacaaaggagctgtgggcaactgtgtt
accaccatggtgcataaccactacgcctcctcaaagaaggtgtctcctcccaagagctcc
aaccagacagccccctccctcaacaatattgtgaaggcagcagctcgtgagggcggtgag
ggcagcgactttgggaagcctcggaagaacttctccagtgtcagtcagtccactcggggc
accaccggcctgctgaggaggaaggaggtgactgaggaggaagctgagaggttcatccag
caggtaaaccaggccgcagtcaccatccaacgctggtaccgctgtcaggtacagaggcgc
cgaacaggagcagcaagcctcgagcacctgctggcatccaagcgagaggggcagaggcaa
cggttgggaagtgggaaccttctggacctgcaccggcaggaggaagcagcaaggaagaag
gcccgggaggagaaggctcgccaggccaggcaggcagccattcaggaactgcagcagaaa
cgagcccagaaagcacgggaagtggagcacaggccacctaaggagagaccagagaccagg
gcactggagcagcctcgacccacccaggagccgccctccatgcccagcagcgtcacacac
cccaaggccaacaatgctggtgccagcctctaccccacaggccccgcagacccctgccct
cctgcctctgaatcattcccagagcgacagccatctctagaggacaagccacaggatgcc
cattcccaggttgaagccagagaggacttggcagcgttggcctcgaccaggagcaagacc
agggccagagcaaccctagatgatcttctggacacgctgaagctgctggaggaggagcct
gagccgctgcttcaccccaaggcctaccgtcaggacagatacgcctggatggatgaggag
gaggataccaaccccctgactgcagacaacctggagaagtttgggaaactcagtgcagcc
cctggcccccccgacgacgggaccctactctccgaggccaagctgcagagcatcatgacc
ttcctggacgagatggagaagtcagggcaggagcggcccgcaccctggcgggagagcctg
gtgctagaggcgggcccaaggtccctggaactggggtctgagggaactacgtccgtgatg
cggctgaagctggagctagaggagaagaaacaggccatggttctgctgcagagagctctg
gcgcaacagcgggacctcgccactcgccgtgttaaggagacagagaaggagctgagccgg
cagctgcggcagcagaaggagcagtacgaggccaccatccagcggcacttgtccttcatt
gaccagctgatcgaagacaagaaagtccttagcgagaagtgtgaggcggtggtggctgag
ctgaagcagggggaccagcggtgtcgggagcgtgtggcacaggtgcaggagcagcacgaa
ctggagatcaagaaactcaaagaactcatgagcgccaccgagaaaatccggcgtgagaag
tggattaacgagaaaacgaaaaagatcaaggaaatcacagtcagaggtctagagcctgag
atccagaaactaattgccaagcacaagcaggaggtgaggaggctcaggggcctgcatgag
gctgagctgcaacagcgcgaggagcaggccgcacagcgccacctgcgtcaggcagaggag
ctgcgggagcacctggagcgggagagggaggcgctgggccagcaagagcgggagcgagcc
cagcagaggttggagcagcacctggagcaggaacagcgggccttggagcagcagcggcga
cggctctacactgaggtggccgaggagaaggagcgactgggccagcaggcagccaggcag
cgggtggagctggaggagctgaggcagcagctggaggagagcagtgcagccctcactcga
gccctgagagccgagttcgagaggagccgagaggagcaggagcggaggcaccagatggag
ctgaaggccctgaaggaccagctggaagctgagagacaggcgtgggtggccagctgtgcc
aagaaggaggaagcatggctgctgaccagggaacgtgagctgaaggaggagatccgaaaa
ggccgagaccaagagattgagttggtcatccaccggctggaggctgatatgaccttggct
aaggaggagagcgagagagcagccgagaaccgtgtgaaacgtgtgcgtgacaagtatgag
accgagctctcggagctggagcagtcggagcgcaagcttcaggagcggtgcacagagctg
aaaggacgtctgggagaggctgaaggggagaaggagcggctgcagtctctactacgccag
aaagagaaggaactggatgacctgcgggtggtaaacacacagatgtgcagtgagcgggcc
agcctggcccaagtggtccgacaggagtttgctgagcagctggcagcctcccaggaggag
acccagagggtgaaggcagagctcgcagagctgcgggcccgtcagcagatggagctagat
gaggtgcatcggagggtgaagacggctctagcgaggaaggaggcagccgtgaacagtctc
cggaaacagcacgaggctgccgagaagcgggcggaccacctggaggagctgctggagcaa
cacaaagggccatctttgagttccaagtga

DBGET integrated database retrieval system