KEGG   Rattus norvegicus (rat): 360673
Entry
360673            CDS       T01003                                 

Gene name
Tepsin, Enthd2, RGD1307410
Definition
(RefSeq) TEPSIN, adaptor related protein complex 4 accessory protein
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: ENTH
Other DBs
NCBI-GeneID: 360673
NCBI-ProteinID: NP_001094199
RGD: 1307410
Ensembl: ENSRNOG00000028161
UniProt: G3V8Y7
Position
10q32.3
AA seq 569 aa
MAAVPPLRDRLSFLHRLPILLKGTSDDDIPCPGYLFEEIAKISHESLGSSQCLLEYLLNR
LDSSSGHVKLKVLKILLYLCSHGSSSFMLILRRNSALIQEATAFAGPPDPLHGNSLYQKV
RAAAQDLGSTLFSDALPQPPSQPPQILPPAGMGAQARPHSALQGFGYTKESSRTGSAGET
FLSTIQRAAEVVVNAVRPGPDNPCTKGPLPHGDAYQPAVTPSASHTHPNPGNLLPAAIQG
TRAVKHQPGQAGGGWDEMDSSPSSQNSSCTSNLSRASDSVSRSGSDSHSGASREPGDLAE
RAEGMAPNDCQQELNLVRTVTQGPRVFLSREETQHFIKECGLLNCEAVLELLLQQLVGTS
ECEQMRALCAIASFGSADLLPQEHILLLCRQQLQELGAGSPGPVTNKATKILRHLEASCG
QQFPTLRPCAQPNSAAAVVGPADLLTSPVPPPGSQVFLQPLSSTAVVPRSPVPTPSPDTL
PPALQDPGELRTQLVCSSEPGTGSEQRLENTDTPKDSSSPCPWSPNSLFAGMELVACTRL
PCPSFQADLQKVTTEPPVSEPSAFAFLNM
NT seq 1710 nt   +upstreamnt  +downstreamnt
atggcagccgttccgccgctgcgagaccgcttgagctttctacataggctccccattctg
ttgaaggggacctcagatgatgacatcccatgcccaggctacctgtttgaagagattgcc
aagatttcccacgagtcactgggcagcagccagtgcctgctggagtacctcctgaaccgc
ctggacagtagctctggccacgtgaagctcaaggtgctgaagatcttgctttacctgtgc
agtcacggctcttcctccttcatgctcatccttaggagaaactctgctctcatccaagaa
gccacagctttcgcggggcctccggatcctcttcatggaaatagcttgtaccagaaagtg
cgggcggctgcccaggacctgggtagcaccctcttctcagacgcactgccacagcctccc
tcccagccgccccagatcctgcctcctgcaggcatgggcgcccaggccaggcctcatagt
gctctacaaggcttcggttatactaaggagagcagccggacaggctctgcaggtgaaacc
ttcctctccaccatccagagggccgcagaggtagtggtgaatgctgtgcgtcctgggcct
gataatccttgtaccaagggacccctgccacacggtgatgcctaccagcctgcagtgaca
ccttcagctagccacacacatcccaaccccgggaatctcctccctgcggctatccagggg
accagagctgtgaaacaccagcccgggcaggctggaggaggctgggatgagatggacagc
agtcctagttcccagaattcctcctgtaccagcaacctgagcagggcctcagactcagtc
agtcggtctggcagtgatagccactctggtgccagccgggagccaggcgacctggcagag
agggctgagggcatggccccaaatgactgccagcaagaactgaatctagtgaggactgtg
acacaggggccacgtgtcttcctgagccgtgaggagacgcagcacttcatcaaagagtgc
ggcctgctcaactgtgaggctgtgctggagctgctcctccagcagctggtcgggaccagt
gagtgtgagcagatgagggcactgtgtgccatagcgtcctttggaagtgctgacctcctt
cctcaggagcacattctcctcctgtgccgacagcagctgcaggaacttggtgcaggcagc
cctgggcctgtgaccaacaaagccaccaagatcctgagacacttggaagcctcctgtgga
caacagttccctaccctaaggccctgtgcccagcccaactctgcagctgctgttgtgggc
ccagctgatctgctgaccagccctgtgcctccccctgggagccaagtcttcctccagcct
cttagttccaccgcagttgtgcccaggagtcctgtgcccactccatctccagatacctta
cctcctgctctgcaggatcccggtgagctcagaacccaattggtatgttctagtgaacca
gggacaggatctgaacagaggctggagaacacagacaccccaaaggatagctccagtccg
tgtccgtggagccccaactctctgtttgctggcatggagctggtagcttgcacccgcctg
ccctgccccagcttccaggcagatttgcagaaggtgaccacagagcctccagtttcagag
ccatccgcttttgcatttttaaacatgtga

DBGET integrated database retrieval system