KEGG   Rattus norvegicus (rat): 360678
Entry
360678            CDS       T01003                                 

Gene name
Arhgdia, Bles01
Definition
(RefSeq) Rho GDP dissociation inhibitor alpha
  KO
K12462  Rho GDP-dissociation inhibitor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04722  Neurotrophin signaling pathway
rno04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    360678 (Arhgdia)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    360678 (Arhgdia)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    360678 (Arhgdia)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   360678 (Arhgdia)
  Exosomal proteins of other body fluids (saliva and urine)
   360678 (Arhgdia)
  Exosomal proteins of colorectal cancer cells
   360678 (Arhgdia)
SSDB
Motif
Pfam: Rho_GDI DUF4249
Other DBs
NCBI-GeneID: 360678
NCBI-ProteinID: NP_001007006
RGD: 1359547
Ensembl: ENSRNOG00000036688
UniProt: Q5XI73
Position
10q32.3
AA seq 204 aa
MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVA
VSADPNVPNVIVTRLTLVCSTAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNR
EIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPMEEAPKGMLARGSYNIKSR
FTDDDKTDHLSWEWNLTIKKEWKD
NT seq 615 nt   +upstreamnt  +downstreamnt
atggcagaacaggaacccactgctgagcagctcgctcagatagctgcagagaatgaggaa
gacgagcactctgtgaactacaagcctccagcccagaagagcatccaggagatccaggaa
ctggacaaggatgatgaaagccttcgaaagtacaaggaggccctgctgggccgagtagct
gtctctgcagaccccaatgtccccaacgtcattgtgacccgcttgaccttggtgtgcagc
actgccccaggccctctggaactggacctgacaggtgatctggagagcttcaagaaacag
tcatttgtgttgaaggaaggtgtggagtaccggataaaaatctctttccgggtgaacaga
gagatcgtgtcaggcatgaagtacatccagcacacatacaggaaaggggtcaaaattgac
aagactgactacatggtcgggagctatgggccaagggctgaggagtatgagttcctgaca
cccatggaagaggcccccaaaggcatgcttgctcggggcagttacaacatcaagtcccgc
ttcacagatgatgacaaaactgaccacctgtcctgggagtggaatctcaccatcaaaaag
gaatggaaggactga

DBGET integrated database retrieval system