KEGG   Rattus norvegicus (rat): 360698Help
Entry
360698            CDS       T01003                                 

Gene name
Tmem50b, RGD1307561
Definition
(RefSeq) transmembrane protein 50B
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: UPF0220
Motif
Other DBs
NCBI-GeneID: 360698
NCBI-ProteinID: NP_001020185
RGD: 1307561
Ensembl: ENSRNOG00000002028
UniProt: Q5BJS6
Position
11q11
AA seq 158 aa AA seqDB search
MAGFLDNFRWPECECIDWSERRNTVASVVAGILFFTGWWIMIDAAVVYPKPEQLNHAFHT
CGVFSTLAFFMINAVSNAQVRGDSYESGCLGRTGARVWLFIGFMLMFGSLIASMWILFGA
YVTQNIDVYPGLAVFFQNALIFFSTLIYKFGRTEELWA
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcttcctggataacttccgatggccggagtgcgagtgtattgactggagtgag
cgcaggaacacggtagcctccgtggttgcaggaatcttgttctttacaggctggtggata
atgatcgatgcggccgtggtgtatcctaagcctgagcaactaaaccacgccttccacacg
tgtggtgtcttctccacgctggccttcttcatgataaatgctgtatccaatgcccaggtg
cgaggtgacagctatgagagcggctgcttaggaagaactggagctcgggtctggctcttc
attggtttcatgctgatgttcggatcgcttatcgcctccatgtggatcctttttggtgca
tatgttactcaaaatattgatgtttaccctggactagctgtgttctttcaaaatgcactt
atattttttagcactctgatctacaaattcggaagaactgaagagctctgggcctga

DBGET integrated database retrieval system