KEGG   Rattus norvegicus (rat): 360704
Entry
360704            CDS       T01003                                 

Gene name
Hmgn1
Definition
(RefSeq) high mobility group nucleosome binding domain 1
  KO
K11299  high-mobility group nucleosome-binding domain-containing protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    360704 (Hmgn1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   HMG (high mobility group) proteins
    360704 (Hmgn1)
SSDB
Motif
Pfam: HMG14_17
Other DBs
NCBI-GeneID: 360704
NCBI-ProteinID: NP_001013202
RGD: 1307761
Ensembl: ENSRNOG00000050978
UniProt: Q5U1W8
Position
11q11
AA seq 96 aa
MPKRKVSADGAAKAEPKRRSARLSAKPAPAKVDAKPKKAAGKDKASDKKAQIKGKRGAKG
KQAEVADQQTTDLPAENGETENQSPASEEEKEAKSD
NT seq 291 nt   +upstreamnt  +downstreamnt
atgcccaagaggaaggttagcgcagatggagcggcgaaggcggagcccaagcgccgctcc
gcgaggctgtcggccaagcccgcccctgccaaggtggacgcgaaaccgaaaaaggccgcg
ggaaaggataaagcatcagacaaaaaagcacagataaaagggaagaggggagcgaagggc
aaacaggctgaagtggctgaccagcaaactacagatctgcctgcagaaaatggagagacg
gaaaaccagagtccagcctctgaggaagagaaagaagcgaagtctgattaa

DBGET integrated database retrieval system