KEGG   Rattus norvegicus (rat): 360721
Entry
360721            CDS       T01003                                 

Gene name
Fam162a
Definition
(RefSeq) family with sequence similarity 162, member A
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: DUF1075
Other DBs
NCBI-GeneID: 360721
NCBI-ProteinID: NP_001025074
RGD: 1590883
Ensembl: ENSRNOG00000002255
UniProt: D4ADP1
Position
11q22
AA seq 178 aa
MWSLRGLRLAAGHCFRLCERNVSSPLRLTRNTDLKRINGFCTKPQESPKAPTQSYRHRVP
LHKPTDFEKKILLWSGRFKKEEEIPETISFEMLDAAKNKIRVKVSYLMIALTVAGCVYMV
IEGKKLEPRKESPSERGGSYEGQSGLDVFVLDLEKPGIFQKPSPSGKAIERERDTVQG
NT seq 537 nt   +upstreamnt  +downstreamnt
atgtggagcctccgcggcctgcgcctggcggctggacattgttttaggttatgtgaaaga
aatgtttcctcgccactaaggttaaccaggaacactgacttgaagaggatcaatggattc
tgcaccaagccacaagaaagtcccaaagctccaacccagtcttacagacacagggtgccg
cttcacaagcccacagacttcgagaagaagatcctgctgtggtcaggccgcttcaagaag
gaggaagagatcccagagacaatctcgtttgagatgcttgacgctgcaaagaacaagatc
cgggtgaaggtcagctatttaatgattgccctaacagtggcaggatgcgtctatatggtt
attgagggcaagaagcttgaacctagaaaggaaagcccgtctgagagaggaggcagctat
gaaggccaaagcggactagacgtatttgtgctggatttggaaaagccaggaatattccaa
aaaccatccccctctgggaaagctattgaaagagaacgagacactgtccagggatga

DBGET integrated database retrieval system