KEGG   Rattus norvegicus (rat): 360730
Entry
360730            CDS       T01003                                 

Gene name
Ostn
Definition
(RefSeq) osteocrin
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Musclin
Other DBs
NCBI-GeneID: 360730
NCBI-ProteinID: NP_997495
RGD: 1303110
Ensembl: ENSRNOG00000030462
UniProt: P61365
Position
11q22
AA seq 132 aa
MLDWRLASAHFLLAMILMLWGSGKAFSVDLASEASEFGAESLQSPPTTREEKSATELAAK
LLLLDDLVSLENDVFETKKKRSFSGFGSPLDRLSAGSVEHRGKQRRVVDHSKKRFGIPMD
RIGRNRLSSSRG
NT seq 399 nt   +upstreamnt  +downstreamnt
atgctggactggagattggcaagtgcacacttcctcctggctatgatcctgatgctgtgg
ggctcaggaaaggcattctccgtggacttagcatcagaggcctccgagtttggagcagaa
agcttgcagtccccacccacaaccagagaagagaagtcagccacggagcttgcagctaag
ctcctgcttcttgatgatctggtgtccttggagaatgatgtgtttgagaccaagaagaag
agaagcttctctggcttcgggtctccccttgacagactctcggctgggtctgtagagcat
agagggaaacaaaggagagtagttgatcattcaaaaaagcgatttggtattcccatggat
cgaattggtagaaaccgtctctccagttccaggggctga

DBGET integrated database retrieval system