KEGG   Rattus norvegicus (rat): 360733Help
Entry
360733            CDS       T01003                                 

Gene name
Rtp4, RGD1306974
Definition
(RefSeq) receptor (chemosensory) transporter protein 4
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-3CxxC zf-3CxxC_2
Motif
Other DBs
NCBI-GeneID: 360733
NCBI-ProteinID: NP_001101791
RGD: 1306974
Ensembl: ENSRNOG00000028895
UniProt: D4A238
Position
11q23
AA seq 245 aa AA seqDB search
MLFSDDFSTWEQRFQELIREEKPGAKWTLHLDKNIVPDGAALGWRQQQQTVVGRFQCSRC
YRSWTSAQVKIVCHMFQDAGKTQGRVLMRIFGQRCQKCFGSQFESPEFSTESIERMLNNL
VNYILQRYYGHRKIASILNASLDEKVLLDGPHDTLNCEACSLHPHGRCAVAQRVRPPRSP
SPSPSPSPKSHSSSPSRSHPPLLQTEITGFRNRPFQEVREPGEAASPLLVILSVAALALI
GFFIR
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgctgttctccgatgacttcagtacttgggagcagagatttcaagaactgatccgggag
gagaagcccggggccaagtggaccctgcacttggataagaacattgtaccagatggtgca
gctctgggatggaggcagcagcagcagacagtagttggcaggttccagtgttccagatgt
tacagaagttggacctctgctcaagtgaagatcgtatgccacatgttccaggatgctggg
aaaacacagggccgggtactcatgaggatctttggtcagaggtgccagaagtgttttggg
tctcaatttgagagccctgagttctccacagagagcattgaaaggatgctgaataacctg
gttaattatattctgcaaagatactacggacataggaagatagcatcaatcttgaatgca
tctttggatgaaaaggtgcttttggatgggccccatgacacattaaattgcgaggcatgc
agtctgcacccccatggaaggtgtgccgttgcacagagagtgaggccacccagatcccca
tctccatctccatcgccatcaccaaagagccacagttcctctccatcaaggagccaccct
cctttacttcagactgagattacaggttttaggaacaggccttttcaggaagtcagagag
cccggtgaagcagcatcaccactattagtgattttgtctgtcgctgcgcttgcccttatt
ggtttcttcattagataa

DBGET integrated database retrieval system