KEGG   Rattus norvegicus (rat): 360737
Entry
360737            CDS       T01003                                 

Gene name
Tbx1
Definition
(RefSeq) T-box 1
  KO
K10175  T-box protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    360737 (Tbx1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Other transcription factors
   T-box
    360737 (Tbx1)
SSDB
Motif
Pfam: T-box
Other DBs
NCBI-GeneID: 360737
NCBI-ProteinID: NP_001101792
RGD: 1307734
Ensembl: ENSRNOG00000001892
UniProt: D4A2E9
Position
11q23
AA seq 480 aa
MHFSTVTRDMEAFAASSLSGLGAPSPGADPFGPREPPPPRYDPCTAAPGAPGPPPPPRAY
PFAPAPGAASSSAAESEGPGASRAAAAKAPVKKNPKVASVSVQLEMKALWDEFNQLGTEM
IVTKAGRRMFPTFQVKLFGMDPMADYMLLMDFVPVDDKRYRYAFHSSSWLVAGKADPATP
GRVHYHPDSPAKGAQWMKQIVSFDKLKLTNNLLDDNGHIILNSMHRYQPRFHVVYVDPRK
DSEKYAEENFKTFVFEETRFTAVTAYQNHRITQLKIASNPFAKGFRDCDPEDWPRNHRPG
ALPLVSAFARSRNPVASPTQPNGADKDVAEARREFDRDSGPAALGDATHPPQLLARVLSP
ALPGPGGLVPLPGGSGGRHSPPHADLRLEAPGASEPLHHHPYKYPAAAYDHYLGAKSRPA
PYPLPGLRGHGYHPHAHPHAHPHHHHHPAVNPAAAAAAAAAANVYSSAAAPPGAYDYCPR
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgcacttcagtacagtcaccagggacatggaagccttcgcggccagcagtctgagcggc
ctgggagccccgtcgcctggcgccgacccgttcggccctcgggagccgccgccaccgcgc
tacgacccgtgcaccgctgcccccggtgccccgggcccgccgcctccgccgcgcgcctac
cctttcgcgcccgcccccggggcggctagcagctcggcggcggagtccgagggtcctggg
gctagccgcgcggccgcggccaaggcgccggtgaagaagaacccaaaggtggccagcgtg
agcgtgcagctggaaatgaaggcgctatgggacgagttcaatcagctgggcaccgagatg
atcgtcaccaaggcaggcagacgaatgttccccaccttccaagtgaagctttttggaatg
gacccgatggctgactacatgctcctcatggactttgtgcctgtggatgacaagcgctac
cggtacgctttccacagctcctcctggctggtggctggcaaggcagatcctgccacccct
ggccgagtgcactaccacccggactcgcccgcgaagggcgcgcagtggatgaagcagatc
gtatctttcgacaagctgaagctcaccaataacctgctggacgacaatggccacattatt
cttaactccatgcacagataccagccccgtttccatgttgtttatgtggaccctcgaaaa
gacagcgagaaatacgcagaggagaacttcaaaacttttgtgtttgaggagacacgcttc
actgcagtcaccgcctaccagaatcaccggatcacgcagcttaagattgccagcaacccc
ttcgccaaaggcttccgggactgcgacccggaggactggccccgaaaccaccggcccgga
gcgctgccgcttgtaagtgcctttgctcgctctcggaatcccgtggcttcccccacgcag
cccaacggagcggacaaagatgtggcagaagcccggcgcgagttcgaccgtgactctgga
cccgcagcgctcggcgacgccacgcacccgccgcagctgctggcgcgcgtgctgagcccc
gcactgcctgggcctggtggcctcgtcccgctacctggcggatccggaggccgccacagt
cccccgcacgctgatctgcgcctggaggctccgggcgcatccgaaccgctgcaccaccat
ccctacaagtacccggcggccgcctacgaccactacctcggggccaagagccggccggcg
ccctacccgctgccaggcctgcgcggccacggctaccacccacatgcgcacccgcacgcg
cacccgcaccaccaccaccacccggcggtgaacccggccgccgccgccgccgcagcagca
gcagccaacgtgtactcctcggcggccgcgccgcccggtgcctacgactactgccccaga
tag

DBGET integrated database retrieval system