KEGG   Rattus norvegicus (rat): 360739
Entry
360739            CDS       T01003                                 

Gene name
Ranbp1
Definition
(RefSeq) RAN binding protein 1
  KO
K15306  Ran-binding protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05166  Human T-cell leukemia virus 1 infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    360739 (Ranbp1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    360739 (Ranbp1)
SSDB
Motif
Pfam: Ran_BP1 WH1 DUF1681
Other DBs
NCBI-GeneID: 360739
NCBI-ProteinID: NP_001101794
RGD: 1310521
Ensembl: ENSRNOG00000001884
UniProt: D4A2G9
Position
11q23
AA seq 203 aa
MAAAKDSHEDHDTSTENAEESNHDPQFEPIVSLPEQEIKTLEEDEEELFKMRAKLFRFAS
ENDLPEWKERGTGDVKLLKHKEKGTIRLLMRRDKTLKICANHYITPMMELKPNAGSDRAW
VWNTHADFADECPKPELLAIRFLNAENAQKFKTKFEECRKEIEEREKKGPGKNDNAEKVA
EKLEALSVREARDEAEEKSEEKQ
NT seq 612 nt   +upstreamnt  +downstreamnt
atggcggccgccaaggacagtcacgaggaccacgatacttccacagagaatgcagaggag
tccaaccacgacccccagttcgagccaatagtttctcttcctgagcaagaaattaaaaca
ctggaggaagatgaagaggaactttttaagatgcgtgcaaagctgttccggtttgcttca
gagaatgacctcccagaatggaaggagcgaggcactggagacgtcaagcttctgaagcat
aaggagaaagggaccatccgccttctcatgaggagggacaaaaccttgaagatatgcgcc
aaccactatatcacaccaatgatggagctgaagccgaatgctggcagtgaccgcgcctgg
gtctggaatacccacgccgactttgctgacgagtgtcccaagcctgagctgcttgccatc
cgcttcctaaatgctgagaacgcacaaaagttcaaaacaaagttcgaagaatgcaggaaa
gaaattgaagagagagaaaagaaaggaccaggcaaaaatgataatgctgaaaaggtggct
gagaagctggaagccctttcagtgagggaggccagagacgaggctgaagagaagtctgag
gagaagcaatga

DBGET integrated database retrieval system