KEGG   Rattus norvegicus (rat): 360745Help
Entry
360745            CDS       T01003                                 

Gene name
Lztr1
Definition
(RefSeq) leucine-zipper-like transcription regulator 1
  KO
K23330  leucine-zipper-like transcriptional regulator 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    360745 (Lztr1)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     360745 (Lztr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kelch_3 Kelch_4 Kelch_1 BTB Kelch_5 Kelch_6 Kelch_2 BACK RAG2
Motif
Other DBs
NCBI-GeneID: 360745
NCBI-ProteinID: NP_001101796
RGD: 1309100
Ensembl: ENSRNOG00000001870
UniProt: B5DFI4
Position
11q23
AA seq 837 aa AA seqDB search
MAGSGGPTGPGALTGGVSSKVAPSVDFDHSCSDSVEYLTLNFGPFETVHRWRRLPPCDEF
VGARRSKHTVVAYKDAIYVFGGDNGKTMLNDLLRFDVKDCSWCRAFTTGTPPAPRYHHSA
VVYGSSMFVFGGYTGDIYSNSNLKNKNDLFEYKFATGQWTEWKIEGRLPVARSAHGATVY
SDKLWIFAGYDGNARLNDMWTIGLQDRELTCWEEVAQSGEIPPSCCNFPVAVCRDKMFVF
SGQSGAKITNNLFQFEFKDKTWTRIPTEHLLRGSPPPPQRRYGHTMVAFDRHLYVFGGAA
DNTLPNELHCYDVDFQTWEVVQPSSDSEVGGAEVPERASSSEEASTLTSEERSSFKKSRD
VFGLDFGTTSTKQPVHLASELPSGRLFHAAAVISDAMYIFGGTVDNNIRSGEMYRFQFSC
YPKCTLHEDYGRLWEGRQFCDVEFVLGEKEECVQGHVAIVTARSRWLRRKIVQAREWLAQ
KLEEDGALAPKEAPGSTVGRARPPLLRVAIREAEARPFEVLMQFLYTDKIKYPRKGHVED
VLLIMDVYKLALSFQLCRLEQLCRQYIEASVDLQNVLAVCECAARLQLGQLKEHCLNFIV
KESHFNQVIMMKEFERLSSPLIVEIVRRKQQPPPRTPSDQPVDIGTSLIQDMKAYLEGAG
SEFCDITLLLDGHPRPAHKAILAARSSYFEAMFRSFMPEDGQVNISIGEMVPSRQAFESM
LRYIYYGEVNMPPEDSLYLFAAPYYYGFYNNRLQAYCKQNLEMNVTVQNVLQILEAADKT
QALDMKRHCLHIIVHQFTKVSKLPTLRLLSQQLLLDIIDSLASHISDKQCAELGADI
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atggcaggctccggaggccccactgggcccggggccttgacaggaggggtgagctccaag
gtggctccgagcgtggactttgaccacagctgctcagacagtgtcgagtacctgacgctc
aactttggacccttcgaaactgtgcatcgctggcggcgcctcccgccctgcgacgaattc
gtaggcgctcggcgcagcaaacacacagtcgtggcgtataaggatgccatctatgtgttt
ggcggagataatgggaagacgatgctcaatgatctcctgcggttcgacgtgaaggattgc
tcctggtgcagagccttcaccaccggcactcctccagccccccggtaccaccactcagct
gttgtctacgggagcagcatgttcgtcttcgggggatatactggagatatttattccaat
tctaacttgaagaataaaaatgacctctttgaatacaagtttgcaactggccagtggaca
gagtggaagattgaaggaaggttgcctgttgccaggtcagcccatggggctacagtgtac
agtgacaagctctggatctttgctggctatgatggcaatgccaggttgaacgacatgtgg
acaattggcctccaagaccgagagctcacatgctgggaggaggtggcccagagcggtgag
atacccccatcctgctgcaacttccctgtggctgtgtgccgggataagatgtttgtgttc
tcaggacagagtggagccaagataaccaacaacctcttccagtttgaattcaaggacaag
acgtggacacgcatccctactgagcacctgcttcggggctccccacccccaccacagcgg
cgctatggacacaccatggtggcctttgaccgtcatctctatgtgtttgggggtgcagca
gacaatacactgcccaatgagctgcactgttatgatgtggacttccagacctgggaggtt
gtccaacccagctctgacagtgaggttggtggggctgaggtgcctgagcgagcttcttct
tctgaggaggcatctactctaacctctgaagagcggagcagctttaagaagtccagagat
gtgtttggcctagactttggcaccacttcaaccaagcagccagtccacctggcatcagag
ctgcccagtgggaggctcttccatgctgctgcagtcatatctgatgccatgtacatcttt
gggggcactgtggacaacaacattcgcagcggggaaatgtacaggttccagttctcttgc
tacccaaagtgcacactgcatgaagattatgggcgcctatgggagggccgccagttctgt
gatgtggagtttgtgcttggtgagaaggaagagtgtgtgcagggtcatgttgccattgtc
actgcaaggagccggtggcttcgtaggaagattgtgcaggcccgagagtggctggcccag
aagctggaggaagatggggccctagctcccaaggaggcccctggctcaactgtgggcaga
gcacggccacccctgttacgtgtggccattcgtgaggctgaggcacggccatttgaggtg
ctcatgcagtttctctacacagacaagatcaagtacccacggaaaggccatgtggaagac
gtgctgctcatcatggatgtgtacaagctggcactgagcttccagctgtgtcgccttgag
cagctgtgtcggcagtacatcgaggcctctgtggatctgcagaatgtgctggctgtgtgc
gagtgcgctgccaggctacaactgggccagctcaaggagcattgcctgaacttcatagtg
aaggaatcccacttcaatcaggtgataatgatgaaggagtttgagcgcctctcatcccca
ctgattgtagagattgttcgtcggaagcagcagccaccccctcgcaccccctctgatcag
cctgtggacattggcacatctttgatccaggacatgaaggcttacctggagggagcaggc
tcagagttctgtgacatcacactactgctagatggccacccacggccggcccacaaagcc
atcctggctgcccgctctagctactttgaggccatgtttcggtcgttcatgccagaggat
gggcaggtaaacatctccattggggagatggttcccagcagacaggcctttgagtccatg
ctgcgctacatctactatggcgaggtcaacatgccccctgaggactcactctacctgttt
gcagccccctactactatggcttctacaacaaccgactgcaggcatactgcaagcagaac
ctcgagatgaatgtaacagtgcagaatgtgctgcagattctggaggcagctgacaagaca
caggcactggacatgaagcggcactgcttgcacatcattgtacaccaattcactaaggtc
tctaagctgcccacactgcggctgctgagccagcagctgctgctggacatcatagactcc
ctggcctcccatatctctgacaagcagtgtgcagagctgggtgctgacatctga

DBGET integrated database retrieval system