KEGG   Rattus norvegicus (rat): 360747Help
Entry
360747            CDS       T01003                                 

Gene name
Spag6, RGD1310892
Definition
(RefSeq) sperm associated antigen 6
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Arm HEAT HEAT_2 Cnd1 HEAT_EZ DNA_alkylation Adaptin_N Proteasom_PSMB Atx10homo_assoc CLASP_N NopRA1 RTP1_C1 HEAT_PBS Vac14_Fab1_bd DUF3361 Tti2 HEAT_UF Rcd1
Motif
Other DBs
NCBI-GeneID: 360747
NCBI-ProteinID: NP_001030132
RGD: 1310892
Ensembl: ENSRNOG00000025787
UniProt: Q3MHU1
Position
11q23
AA seq 507 aa AA seqDB search
MSQRQVLQVFEQYQKARTQFVQMVAELATRPQNIETLQNAGVMSLLRPLLLDVVPTIQQT
AALALGRLANYNDDLAEAVVKGDILPQLVYSLAEQNRFYKKAAAFVLRAVGKHSPQLAQA
IVDCGALDTLVICLEDFDPGVKEAAAWALGYIARHNTELSQAVVDAGAIPLLVLCIQEPE
IALKRIAASALSDISKHSPELAQTVVDAGAIAHLAQMILNPDAKLKRQVLSALSQIAKHS
VDLAEMVVEAEIFPVVLTCLKDKDEYVKKNACTLIREIAKHTPELSQLIVNAGGVAAVID
CIGSSKGNIRLPGIMMLGYVAAHSENLAMAVIISKGVPQLSICLSEEPEDHIKAAAAWAL
GQLGRHTPEHARAVAVTNTLPVLLSLYMSAESSEDLQLKSKKAIKNILQKCTYLPALEPF
LYDAPPNILKHVVGQFSKVLPHDSKARRLFVTSGGLKKVQEIKAEPGSLLQEYINSINNC
YPEEIVRYYSPGYSETLLQRVDSYQPQ
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcggcaggtgcttcaagtgttcgagcagtaccagaaagcccggacgcaattc
gtgcagatggtggcagagctggcgaccagaccccaaaacatagaaacgctacagaatgca
ggtgtaatgtctttgctaaggccgcttcttctggatgtggtcccaacaattcaacagact
gctgctttggctctggggagactggcgaattacaatgatgacctggcagaagcagttgtg
aagggcgacattcttccacagcttgtttattcattggcagaacaaaatcgtttctacaaa
aaggcagctgcctttgtgctgagagcagttggtaaacactctcctcagctggcccaggcc
atagttgactgtggagctctggatacactggtgatatgcttggaggattttgaccctgga
gtcaaggaggctgcagcctgggcacttggatatattgcaagacacaatacagaattatct
caagctgtggtggatgcaggagcaattcctcttttggttctgtgtatccaggagccagaa
attgctttgaaaaggattgctgcctcggccctcagtgatatctcaaagcactccccagag
ttagcgcagacagtggtggatgccggagccattgctcacctagcccagatgatcctcaac
cctgatgccaaactgaagcgccaggtactctcagctctcagtcagattgcaaaacactct
gtggacctggcagagatggtcgttgaagcagaaattttccctgttgtactaacctgcctg
aaggacaaagatgaatatgtgaagaaaaatgcttgcaccttaattagagaaattgcaaaa
catacgcctgagctctcccagctgattgttaatgccggaggtgtggctgctgtgattgac
tgcatcggatccagcaaagggaacatacggctccctggcatcatgatgctgggctatgtg
gctgctcattctgagaacctggccatggcggtgatcatctccaagggtgtaccccagttg
tcaatctgcctgtcagaggaaccagaagatcatattaaggctgctgctgcctgggccctg
gggcagctgggaagacacactccagagcatgccagggctgtagctgtcacaaacactctg
ccagttctcctgtctttgtacatgtcagcagagagctctgaggacctgcagctgaagagt
aaaaaagccataaagaacatccttcaaaaatgtacctacctaccagccctcgagccattc
ttgtacgatgcacctcccaatatcctgaaacatgttgttgggcagttcagtaaggtgctg
ccacacgacagcaaagcccgacggctttttgtgacaagtggtggacttaaaaaggtccag
gagataaaagcagagccaggctctctcctgcaggaatacatcaacagcatcaacaattgc
tacccagaagaaatagtaaggtattattcgcctggatactctgagacacttctgcagagg
gtggacagctaccagccacagtga

DBGET integrated database retrieval system