KEGG   Rattus norvegicus (rat): 360748Help
Entry
360748            CDS       T01003                                 

Gene name
Prkdc
Definition
(RefSeq) protein kinase, DNA activated, catalytic polypeptide
  KO
K06642  DNA-dependent protein kinase catalytic subunit [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03450  Non-homologous end-joining
rno04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    360748 (Prkdc)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    360748 (Prkdc)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    360748 (Prkdc)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    360748 (Prkdc)
   03400 DNA repair and recombination proteins [BR:rno03400]
    360748 (Prkdc)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     360748 (Prkdc)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   360748 (Prkdc)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     360748 (Prkdc)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA-PK complex
     360748 (Prkdc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NUC194 FAT PI3_PI4_kinase FATC FANCI_S2
Motif
Other DBs
NCBI-GeneID: 360748
NCBI-ProteinID: XP_003751148
RGD: 1308982
Ensembl: ENSRNOG00000025028
UniProt: D3ZTN0
Position
11q23
AA seq 4126 aa AA seqDB search
MADPGAGLRCWLLQLQEFVSAADRYNAAGASYQLIRGLGQECVLSTCSAVQALQISLVFS
KEFGLLVFIRKSLSIDEFRDCREEALKFLCVFLEKIDQKVLHYSFDIKNTCISVYTKDRT
AKCKIPALDLLIKLLKILRSSRVMDEFKIGELFNKFYGELVSKSKLPDTVLEKVYELLGV
LGEVHPSEMVNHSENLFRAFLGELKTQMTSTVREPKFPVLAGCLKGLSSLLCNFTKSMEE
DPQTSKEIFGFTLKAIRPQIEMKRYAVPLAGLRLLTLHASQFTTCLLDNYITLFEVLSKW
CNHTNVELKKAAHSALESFLKQISFTVAEDAELHKSKLKYFMEQFYGIIRNADSNNKDLA
IAIRGYGLFAGPCKVINAKDVDFMYVELIQRCKQMFLTQTDATEDHVYQMPSFLQSIASV
LLYLDTVPEVYTPVLEHLMVVQIDSFPQYSPKMQLVCCKALVKVFLSLTEKGPVHWNCIS
AVVHQGLIRICSKPVVLQKDVESRSENRWASEEVRMGRWKVPTYKDYVDLFQNLLGCDQM
ADFILGDETFLFVNSSLKSLNHLLYDEFIRSVLKIVEKLDLTLEKQTTGEQEDERTADVW
VIPTSDPAANLHPIKPNDFSAFINLVEFCREILPKKQVSFFEPWVYSFAYELILQSTRLP
LISGFYKLLSIAVKNARKIKYFEGVSPKCLKHSPENTEKHSCFALFAKFGKEVSVKMKQY
KDELLASCLTFVLSLPPDIIKLDVRAYVPALQMAFKLGLSHLPLAEIGLHALKEWSVHID
KSIMQPYYKDIVPCLDGYLNTSTLSDETKSHWEVSALSRAARKGFNRDVVKLLKRTRNVT
SDEALSLEEIRIRVVQILGSLGGQINKNLITATSGERMKKYVAWDREKRLSFAVPFREMK
PVIYLDVFLPRVTELALSASDRQTKVAACELLHSMVMFMLGRATQMPEGQGLPPMYQLYK
HMFPVLLKLACDVDQVTRQLYEPLVMQLIHWFTNNKKFESQDTVALLEAILDGIVDPVDS
TLRDFCGQCVQEFLKWSIKQTTPQQQEKSPVNSKSLFKRLYSLALHPNAFKRLGAALAFN
HIYKEFREEGSLVEQFVFEALVTYMESLALAHADEKSLGTIQQCCDAIDHLRRIIEKKYI
SLNKAKKRRLPRGFPPLTSLCLLDLVKWLFAHCGRPQTECRHKSIELFYKFVPLLPGNKS
PSLWLRDLIKAEGISFLINTFEGGASSSGQPSGILAQPTLLHLQGPVSLRGMLQWLDHLL
AALECYNTFIEEKTVQVQEVLGTEVQSSLLKSVAFFLESIATCDARTVEQRFGTGLTGPP
SVQEEEKYNYSKCTVLVRIMEFTTTLLVTFPEDCKLLEKDLCNTKLMKVLVKMLCEPLSI
GFNIGDVQVMNHLPSICVNLLKALRKSPYRDKLETHLKEKVTAQSVEELCAINLCSSAAC
QERTKLLSLLSACKQLHKAGFSHIISASQSTALNHSIGMRLLSLVYNGIAPAQEKQYLQS
LDPSCKSLASGLLELAFAFGGLCEHLVSLLLNSSMLSTQYLGSSQRNISFSHGEYFYSLF
PEVINTELLKSLDVTVSRLLESSSDNPKMVSTILNGMLDMSFRDRAVQKHQGLKLATAIL
QNWRKCDSWWAPDSAPESKTTVLSLLAKMLQIDSTLSFDTNHSSFSEIFTTYANLLADTK
LGLHLKGQAVILLPFFTRVTEDRLGDLKHILEKFIVLNFPMKSDEFPPDSLKYNNYVDCM
KKFLDALELSQSPMLLQLMTDILCREQQHIMEELFQTTFKRIARRSPCVTQLNLLESVYT
MFRKGGLLSDVTQAFVDRSLLTLLWHCDLDTLKEFFSRIVVEAIDVLKSRFTKLNDTFDT
QITKKMCYYKMLAVMYSRLLKDDVHSKESKINQAFQGSCVAEGNELTKTLLKLCHDAFTE
NMAGESQLLEKRRLYHCAAYNCAISLISRVFNELKFYQGFLFSEKPEKNLFIFENLIDLK
RCYTFPIEVEVPMERKKKYVEIRKEARDAANGASGNPRYMSSLSYLTESSLSEEMSQFDF
STGVQSYSYSSQDRKPTTGHFQRREHQDSMAQDDIIELEMDELNQHECMAPMTSLIKHMQ
RNVIAPKGQEGSISKDLPPWMKFLHDKLENASVSLNIRLFLAKLVINTEEVFRPYAKHWL
GPLLQLAVCENIGEGIHYMIVEIVATILSWTGLATPTGVPKYEVLANRLLYFLMKYVFHP
KRAVFRHNLEIIKTLVECWKECLSIPYRLIFEKFSNKDPNSKDNSVGIQLLGIVVANNLP
PYDLKGDITSAMYFEALVNNMSFVKYKEVYAAAAEVLGLILQHVTERKHVIAESVYELVV
KQLKQHQNTMEDKFIVCLNKIVKGFPPLADRFLNALFFLLPKFHGVMKTLCLEVVLCRAE
AITGLYLQLKSKDFLQVMRHRDDERQKVCLDIIYKMVAKLKPTELRELLNPVVEFVSHPS
PTCREQMYNILMWIHDNYRDPESQMDEDSQEIFKLAKDVLIQGLIDENLGLQLIIRNFWS
HETRLPSNTLDRLLALNSLYSPKIEVHFLSLATNFLLEMTRMSPDYLNPIFEHPLSECEF
QEYTIDPDWRFRSTVLTPMFIETQAFPSTLNTQTQEGSPSDRRQKPGQVRATQQQYDFTP
TQTSVERSSFDWLTGSSIDLMADHTVFSSESLSSSLLFSHKKSEKSQRVSWKSVGPDFGT
KKLGLPGDEVDNQVKSGTHSQTEILRLRRRFLKDQEKLSLLYAKRGLMEQKLEKDIKSEL
KMKQDAQVVLYRSYRHGDLPDIQIQHSSLITPLQAVAQKDPIIAKQLFSSLFSGILKEMH
KFRTTSEKNIIIQNLLQDFNRFLNTTFLFFPPFVSCIQEISCQHVDLLTLDPAAVRVGCL
ASLQQPGGIRLLEEALLHLLPKEPPTKRIRGKTCLPPDVLRWMELAKLYRSIGEYDVLHG
IFSSELGTKQDTQNALLAEARSDYFQAANLYKEALNKLEWLDGEPTEAEKEFWEMASLDC
YNNLSQWKELEYRSTVNIGSENSLDLSKMWSKPFYQETYLPYVIRSKLKLLLQGEDNQSL
LTFVDEAMHKELQQMVLELQYSQELSLLYILQDDIDRATYYIKNAIQIFMQNYSSIDVLL
YRSRLAKLQSVQTLAEIEEFLNFIRKHGDLSSLGPLRRLLKTWTSRYPDTVTDPMHIWDD
IITNRCFFLSKIEERLTVSPGDHSMSVDEDEDSFAREGSEPKEDAHHILQSCRFTMKMKM
IESSWKQNNFSLSMKLLKEMHKESKIRESWRMQWIHSFCQLNHCRSHTQSPQEQVLTMLK
TITLLDESDISNYLNKNIQAFCDQNILLGTSCRIMADALSREPACLSGLEKSKTESIFAL
SGSNTENTERVISGLYQRAFHHLSMAVQSAEEETQLSCWGHEAAAERAHAYMTLVGFCDQ
QLRKVEESASTASQKISTELEGYPALVVEKMLRALKLNSSEARLKFPRLLQIIEQYPEET
VNIIIKEISSIPCWQFIGWIGHMVALLDKEEAIAVQHTVEEIADNYPQAIIYPFIISSES
YSFQNTSSGHNNKAFVERIKSKLDQGGVIQGFINALDQLSNPDMLFKDWVNDTKDELGKN
PVNKKNIEKLYERMYAALGDFRAPGLGPFRRKFIQTFGKEFVKSFGNGGSKLLTMKLDEF
RNITDSLFVRMRKDSKLPGNLKEYSPWMSEFTVKSELEIPGQYDGKSKPLPEYHVRISGF
DERVKVMVSLRKPKRIVIRGHDEKEYPFLVKGGEDLRQDQRIEQLFEVMNAILSQDAACS
QRNMQLRTYRVVPMTSRLGLIEWIENTMTLKDLLLSNMSQEEKVAYDSDSKAPIYDYRDW
LIKVSGRSDVKGYTLMYSRANRTETVTAFRRRENKVPADLLKRAFVKMSTSPEAFLALRS
HFASSHALLCISHWLLGIGDRHLNNFMVAMETGSVIGIDFGHAFGSATQFLPIPELMPFR
LTRQFISLMLPMKETGLVCTVMVHALRAFRSCAGLLTDTMEVFVKEPSFDWKGFEQTMLR
KGGSWIQEINVTEKNWYPQHKIRYAKRKLAGANPAVITCDELRLGHEASPAFRSYVAVAR
GNKDYNIRAQEPESRLSEETQVKCLVDQATDPNILGRTWEGWEPWM
NT seq 12381 nt NT seq  +upstreamnt  +downstreamnt
atggcggacccgggggccggcttgcggtgctggctactacagctgcaggagttcgtgtcc
gcagcagaccgctacaatgctgccggggccagttaccagctgatccgtggcctggggcaa
gagtgcgtgctgagcacttgctctgcagtgcaggcattgcagatctccttagttttttcc
aaagagtttggtttgcttgtatttatccggaagtcacttagcattgatgaatttcgtgat
tgtagagaagaagccctaaaatttttatgtgttttcttagaaaaaattgaccagaaggtt
ctgcattactcttttgatattaagaatacttgtatcagtgtttatacaaaagatagaact
gctaaatgtaaaattccagccttagatcttctgattaagttacttaagatactaagaagt
tccagagtcatggatgaatttaagatcggagaattatttaacaaattctatggagaactt
gtatcaaaatcaaaactacctgatacagttttagaaaaagtctatgagctcctgggagtg
ttaggtgaggttcatcctagtgaaatggtaaatcattcagaaaacctgttccgggcattt
ctgggagagcttaagacccagatgacatctacagtcagagaacctaaatttcctgtccta
gctggctgtctaaagggactgtcctcacttctgtgcaacttcaccaagtccatggaagaa
gatccccagacttcaaaggaaatatttggttttacattaaaagcaattcgtcctcagatt
gagatgaagcgatacgctgtgcccttagctggcctacgactacttaccctacatgcatct
caatttactacctgccttctggacaactatattactttatttgaagtactgtcaaagtgg
tgtaaccatacaaatgtggaattaaaaaaagctgcacattcagccctggagtccttcctg
aaacagatttcatttactgtggcagaagatgcagagttgcataagagtaagctgaagtac
ttcatggaacagttctatggaatcatcagaaatgcagattcaaacaacaaggacttagcc
attgctattcgtggatatggactatttgcgggaccttgcaaggttataaatgcaaaagat
gttgacttcatgtacgtggagctcattcagcgctgtaagcagatgttcctcactcagaca
gatgctactgaggatcatgtttaccagatgccaagtttccttcagtctattgcaagtgtg
ttgctttaccttgacacagttccagaggtatatactccagtactggaacatctcatggtg
gtacagatagacagcttccctcagtatagtcccaaaatgcagttggtgtgttgtaaagca
ctagtaaaagttttcctatccttaacagagaagggaccagttcactggaattgcattagt
gctgtggtgcatcaaggtttaattcgaatatgttctaaaccagtggttcttcaaaaggat
gttgagtcaaggtctgaaaaccgttgggcctcggaggaagtcagaatgggcaggtggaaa
gtacccacatacaaagactacgtggatctttttcagaatcttttaggctgtgaccagatg
gcggattttatcttaggagatgaaacatttctttttgtaaattcctcccttaaaagtctg
aatcatttactctatgatgaatttataagatcagttttgaagattgtggaaaagttggat
cttacactggaaaaacagactactggagagcaggaggacgaacgcactgctgatgtctgg
gtgatcccaacttcagatccagccgctaacttgcaccctataaaaccaaatgatttttca
gcattcattaacctggtggagttttgcagggagattcttcctaagaaacaagtaagcttt
tttgagccatgggtgtactcatttgcatatgagttaattttacagtctacacgcttacca
ctcatcagtggtttctacaaattgctttctattgcagtgaaaaatgccaggaaaataaaa
tattttgagggagttagcccaaagtgtctgaaacattctcctgaaaatacagaaaagcat
tcttgctttgctttatttgcaaaatttggcaaagaggtgtcagttaaaatgaagcagtac
aaggatgaacttttggcttcttgtttaacatttgttctgtccttgccacctgacatcatt
aaacttgatgttcgagcctatgttcctgcattgcagatggctttcaagctgggcctgagc
catctgccattggcagaaataggtctgcatgcccttaaagaatggtcagttcacattgac
aagtctataatgcagccttactacaaagacatcgtcccctgccttgatggatacctgaat
acgtcaaccttatcagatgaaaccaagagccactgggaagtgtcagcactttctcgggct
gctcggaagggatttaatagagatgtagtgaagcttctgaaaaggacaagaaatgttaca
tctgacgaagcactgtccttagaagaaataagaattagagtagtacaaatacttggatct
ctgggaggacaaataaacaaaaatcttataacagctacatcaggagaaaggatgaagaag
tatgtggcgtgggacagggagaaaagactcagctttgcagtacccttcagagagatgaag
cctgtcatctatctggatgtctttctgcctcgggtcactgaattggctctttctgctagt
gatcgacaaactaaagtagcagcttgtgaactgttacacagcatggttatgttcatgttg
ggaagagccactcagatgcctgaaggtcaggggttgcctcccatgtaccagctttataag
cacatgtttcctgtgctgcttaaacttgcatgtgatgtggatcaagtgacaaggcaactc
tatgaaccacttgttatgcagctcatccactggtttactaacaataagaaattcgaaagt
caagatactgtcgccttattagaagccatactggatggcattgtggatcctgttgacagt
actttaagagatttttgtggacagtgtgttcaagaattcctcaaatggtccattaagcaa
acaacacctcagcagcaagagaagagcccagtaaacagcaagtcacttttcaagcggctc
tacagccttgcactacatcctaatgcgttcaagaggctaggcgcagcacttgcttttaat
cacatctacaaggaattcagggaagaaggatccctggtagaacagtttgtttttgaagcc
ttagtgacatatatggaaagtctggccttggcacatgcagatgagaaatccttaggtaca
attcagcagtgctgtgatgccattgatcacctaagacgcatcattgaaaagaagtacatt
tctttaaacaaagcaaaaaagcggcgtttgccacggggatttccacctttgacatcatta
tgtttattggatctggtcaagtggcttttcgctcactgtggaagaccccagacagaatgt
cgacacaagtccatagaactcttttataaatttgttcctttattaccaggcaacaaatcc
ccttctttatggttgagagatcttataaaagcggaaggtatttcttttctcataaacaca
tttgaaggaggggcaagcagcagcggtcagccatcaggcattcttgctcagccaaccctc
ctccacttgcaagggccagtcagcctgcgaggaatgctccagtggctggaccacctcctt
gcagcactggagtgctacaacacatttatcgaggagaagactgtacaagtgcaagaggtc
ctgggtactgaagtacagtcttcacttttgaagtctgtggccttctttttggaaagcata
gcaacatgtgatgctagaacagtagaacaacgctttggcactgggctgaccggccctccc
agtgtccaagaggaagaaaaatacaattacagcaaatgcacagtcttggtccggattatg
gaatttaccacaaccctgctcgtcacctttccagaagattgcaagctcctggagaaggac
ttgtgtaacacaaagcttatgaaggtcttagtgaaaatgctctgtgagcccctgagcata
ggtttcaatattggcgacgtccaggttatgaaccatcttcccagcatttgtgtgaacctg
ctgaaagcattgaggaagtccccatacagagacaagctggagactcacctgaaggagaaa
gtgacagcacagagtgttgaagagctctgtgctattaacttgtgtagctctgcagcttgc
caagaaaggaccaagttgctgtctctcttatcagcttgtaaacagcttcacaaagctggt
ttctctcatattatatctgcatctcagtctacagcattaaaccattccattggcatgaga
ctgctgtccttggtttataatggcattgcgcctgcacaggaaaagcagtacctgcagtct
ttggatcccagctgtaagagcctggccagtggactcctggaattagcctttgcttttgga
ggactgtgtgagcatcttgtgagtttgctcctgaattcatcaatgttgtctacacaatat
ctgggcagttcacagagaaacattagcttctcccatggggagtatttctacagtttgttt
ccagaagtaatcaacactgaactgttgaaaagtcttgatgttactgtatcaaggcttctg
gagtcatcttcagataatcccaaaatggtgagtactattttaaatggtatgttagatatg
agcttcagggatcgagctgttcagaaacaccaaggactgaagcttgcgactgcaattctg
caaaactggaggaagtgtgattcatggtgggccccagattctgctccagagagcaaaacg
actgtgctgtccttactggcaaaaatgttgcagattgattcaactttatcttttgataca
aatcacagctcattttctgaaatcttcacaacgtatgctaatctacttgcagatacaaag
ttgggtctacacttaaagggccaagccgtcatccttcttccattcttcaccagagtgaca
gaagacaggctaggagacctaaagcacattctggaaaagttcattgttcttaatttcccc
atgaagtctgacgaatttcctcctgattccctgaagtacaataattatgtggactgcatg
aaaaagttcctagatgctttggaattatctcagagtcctatgttgcttcagttgatgaca
gacattctttgtagggaacagcaacatattatggaagaattgttccaaaccaccttcaaa
aggatcgctaggcggagtccatgtgtcacacaattaaatcttttggaaagtgtatacaca
atgttccggaagggtggcctcctttcagatgtcactcaggcattcgtggatcgctctctc
ctcaccttgttgtggcactgtgacttggacacactgaaagagttctttagcagaattgtg
gtggaggccattgatgtgttgaagtccagatttacaaagctaaatgacacttttgacact
caaatcaccaagaagatgtgctattacaagatgctagctgtgatgtattctcgtctttta
aaagatgatgttcactctaaagaatctaaaattaatcaagctttccaaggctcctgtgtt
gcagaaggaaatgaacttacaaagacacttcttaagttgtgccacgatgcatttacagag
aacatggcaggggaaagccagttactggaaaagagaagactttatcattgtgctgcatac
aactgtgccatttctctgataagccgagtcttcaatgagttgaaattttaccaagggttt
ttgtttagtgaaaaaccagaaaagaatttgtttatttttgaaaatttgatagacctgaaa
cgttgctatacatttcctatagaagttgaggttcctatggaaagaaagaaaaagtacgtt
gaaattaggaaagaggccagggatgcagcaaatggggcttcaggcaatcctcgttatatg
tcttcattgtcatatttaacagagagtagcctaagtgaagaaatgagtcaatttgatttc
tcaactggagttcagagctattcatacagttctcaagatcgtaaacctacgacgggccat
tttcagagaagggagcatcaagattccatggctcaggatgacatcatagagttagagatg
gatgagctcaatcaacatgaatgtatggcacccatgacatccctgattaaacacatgcag
agaaatgtgattgcacccaagggacaagagggttcaatatcaaaagatcttccaccttgg
atgaaatttctccatgacaaactagaaaatgcgtcagtatctttaaatatccgtctcttc
ttagccaagcttgttattaatacagaagaggtctttcgcccttatgcaaagcactggctg
ggccccctgctacagctagctgtttgtgagaacattggagaaggaattcactacatgata
gtagaaatagtagctaccattctctcttggacaggcttggctacacctacaggagtccct
aaatatgaagtcttagcaaatcgattgctttattttctaatgaaatatgtcttccatccc
aaaagagctgtgtttagacacaaccttgaaatcattaaaacccttgttgaatgctggaag
gagtgtctgtccatcccttacaggttaatatttgaaaaattttccaataaggaccccaat
tctaaagacaattctgtaggaattcaattattgggcattgtagtagctaataacttgcct
ccctatgacctaaagggtgacatcacgagtgccatgtattttgaagctttagtcaataac
atgtcctttgtgaagtataaagaagtatatgcagctgcagcagaagttctaggactcatt
cttcaacatgttactgagagaaaacacgtgatagcagagtcggtatatgaactggttgta
aaacaactaaagcaacatcaaaatactatggaagacaaatttatcgtatgcttaaacaaa
atagtgaagggcttccctcctcttgctgacaggttcttgaatgctttgttctttctgctg
ccaaaatttcatggagtaatgaagacgctttgtctggaagtggtactttgtcgagcagag
gcgatcacaggcctatacttacagttaaagagtaaggactttcttcaagtcatgagacat
agagatgatgaaagacaaaaggtgtgtttggatataatttataagatggtggcaaaatta
aaaccaacggaactccgagaacttctgaatcctgttgtggaatttgtttcccatccttct
ccaacatgtagagaacaaatgtataatattcttatgtggattcatgacaattacagagat
ccagagagtcaaatggatgaagactcccaggaaatatttaaactcgcaaaagatgtgctg
attcaaggactgattgatgagaaccttggactccaactaattattcggaatttctggagc
catgaaacgagattgccatccaatacattggaccgattgttggcattaaattctttatat
tctcccaagatagaagtccactttttaagtttagcaacaaattttctgcttgaaatgacc
aggatgagcccagattatctaaaccccatttttgagcatcctctttcagaatgtgaattt
caggaatatactatagatcctgactggcgttttcgtagtactgttcttaccccgatgttt
attgagacccaggcctttccaagtactctcaatacccaaacccaagaagggtccccgtca
gaccgaaggcagaagcctggacaagtgcgggccacccaacagcagtatgatttcactcca
acacaaacttcagttgaaaggagctcatttgattggctaactggaagcagcattgaccta
atggcagatcatacagtcttctcttcagagtccttgtcttcttccttgctgttttcccac
aagaagagtgaaaagtcacaaagagtatcctggaagtcagtaggacctgacttcgggaca
aaaaagctgggcctgcctggtgatgaggtggataaccaagtaaaaagtggcactcacagc
cagacagaaattctgagattacgcagacgatttttaaaggaccaagaaaaactgagtttg
ctgtatgccaaaaggggtctcatggagcaaaaactagaaaaggatatcaagagtgagtta
aaaatgaagcaggatgcccaggttgttctttacagaagttatcgtcatggcgaccttcct
gatatccagatccagcacagcagtctgatcacccccttgcaggctgtggcccagaaagac
ccaataattgcaaaacaactcttcagcagcttgttttctgggattttgaaagaaatgcat
aaatttaggaccacatctgaaaagaacatcatcatccaaaatttgcttcaagacttcaac
cgcttcctcaatacaactttcttgttctttccaccctttgtctcttgcatccaggaaata
agttgccaacacgtagacttgctgacacttgacccagccgcagttcgagtgggatgcctg
gccagtctgcaacagcctggaggtattcgtcttctggaagaggccctacttcacctgctg
cccaaggaaccacccaccaaacgaatccggggcaagacttgcttgcctcccgatgttctc
cggtggatggaacttgctaaactctatcgatcaattggggaatatgatgtcctccatggc
atttttagcagcgagttaggaacaaagcaggacactcagaacgcactgttagcagaagcc
agaagtgattattttcaagctgctaacttgtataaggaggctttaaataaattggagtgg
ttagatggtgaacccacagaagctgagaaggagttctgggagatggcatcccttgactgt
tacaacaacctctctcaatggaaagaacttgagtacaggtctacagtcaatataggcagt
gagaactctcttgatctaagtaaaatgtggagcaaaccattttaccaggagacgtatctt
ccttatgtgatccgcagcaaactgaagctcttgcttcaaggagaagacaaccagtctctg
ctaacatttgtggatgaagccatgcacaaagagctgcagcagatggtcctagaacttcag
tatagtcaagagctgagtcttctttacatcttacaggatgatattgacagagccacatac
tacattaaaaatgccattcagattttcatgcaaaattattctagtattgatgtcctcttg
tatagaagtagactcgccaaattacagtctgtacagactttagcagaaattgaggagttc
ctcaattttatacgtaaacatggtgatttatcatctctgggtcccctaaggaggcttctg
aaaacctggaccagcagatacccagatactgtgacagacccaatgcacatctgggatgac
atcatcacaaatcgctgcttttttctcagtaaaatagaggagagactgactgtttctcca
ggagatcacagtatgagtgtggatgaggatgaagattcctttgccagggaagggtccgag
ccaaaggaagatgctcatcacatccttcagagctgcagattcaccatgaagatgaagatg
atagaaagctcctggaagcagaataatttctcactttccatgaaactcctgaaagaaatg
cataaagaatcaaaaataagagagtcttggcgaatgcagtggatacacagtttctgccag
ctgaaccactgccggagccacactcagagccctcaggaacaagtcctcaccatgctcaag
accatcacactgttggatgaaagtgatatttcaaactacttaaataaaaacattcaggcc
ttttgtgaccagaacatcctcttgggcacaagttgcaggatcatggctgatgctctcagc
agggagccagcctgcctgtctggcctggagaaaagtaagacggaatccatctttgcactt
tccggatctaatacggagaacacagagagggtaatctcaggtctgtaccagagagcattc
catcacctctccatggctgtgcagtcagctgaagaggagacccaactttcctgttggggc
catgaggctgcagctgagagggcccatgcttatatgacactggtaggtttctgtgaccaa
caactccgaaaggtagaagagagtgcatccactgcctcacagaagataagtacagaactg
gaaggatatccagcacttgtggtggagaaaatgttgagagcgttaaagttgaactcttct
gaagccaggctgaaatttcctagattacttcagattatagaacaatatccagaagagacc
gtaaacataataataaaagagatttcatccattccttgctggcagttcattggctggatc
ggccacatggttgccttactggacaaagaggaagctattgcggtgcagcataccgtggaa
gaaattgctgataactatccacaggccattatctacccttttataataagcagtgaaagc
tactcctttcaaaatacttcttctggccataataataaagcatttgttgagaggataaaa
agtaaacttgatcaaggaggagtgattcaaggttttattaatgccttagaccagctctcc
aatcctgatatgctctttaaggactgggttaatgatacaaaagatgaactaggaaagaat
cctgtgaataagaaaaatattgaaaaattgtatgaaaggatgtatgctgccttgggtgac
tttcgggctccaggcctggggccctttcggaggaagttcatacagacctttgggaaagaa
tttgtcaaaagctttgggaatggtggttctaagctgcttacaatgaagctcgatgagttt
cgcaatatcactgactcactatttgtaaggatgagaaaagactcaaagctacctgggaac
ctgaaagagtattccccctggatgagtgagttcacagtgaagagtgaactggagattcct
ggacaatatgatgggaagagcaaaccattgcctgagtatcatgtgcggatctctggattt
gacgagcgggtaaaagtaatggtctccttgaggaaaccaaagcgcattgttattcgaggc
catgatgaaaaggaatacccattcctggtaaaaggtggtgaggacctccgacaagaccag
cgcattgagcagctctttgaggtcatgaatgccatcctctctcaggatgctgcctgcagt
cagagaaacatgcagttaaggacttaccgtgttgtgcccatgacctctagattaggatta
attgaatggattgaaaatactatgaccttgaaggaccttcttttgagtaatatgtcacaa
gaggagaaagtggcttatgacagtgattccaaagcaccaatttatgactacagagactgg
ctgataaaagtgtcagggagaagtgatgttaaaggctacacactaatgtacagcagagct
aaccgtacagaaacagttacggcttttagaagaagggaaaataaagtacctgctgatctc
ttaaagcgggcctttgtgaagatgagcaccagccctgaggccttcctggcacttcgttcc
cactttgccagttctcacgcactgctgtgcatcagccactggctccttggtattggagac
agacacctgaacaatttcatggtggccatggaaacaggcagtgtgattggaattgacttt
ggacatgcttttggatcagctactcagtttcttccaatccctgagttgatgccttttcgt
ctaacccgccaatttatcagtctcatgttgccaatgaaagaaacgggtcttgtgtgcaca
gtcatggtgcatgcactgagggctttccgctcgtgtgcaggtctgctcactgataccatg
gaagtttttgtgaaggaaccctcctttgattggaagggttttgagcagacgatgctaaga
aaaggaggatcatggattcaagaaataaatgtaactgaaaagaattggtatccacaacac
aaaatacgctatgctaagagaaagttagcaggggccaacccagcagttataacttgtgat
gaactacgtctaggccatgaagcttcaccagccttcagaagttatgtagctgtagctcga
ggcaacaaagactacaacattcgtgcacaagagccagagagtagactttcagaagagact
caagtgaagtgcttggtggatcaggcgacagaccccaacatccttggcaggacttgggaa
ggatgggagccttggatgtaa

DBGET integrated database retrieval system