KEGG   Rattus norvegicus (rat): 360768Help
Entry
360768            CDS       T01003                                 

Gene name
Ccz1b, Ccz1, RGD1306410
Definition
(RefSeq) CCZ1 homolog B, vacuolar protein trafficking and biogenesis associated
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1712 IF4E PRAP
Motif
Other DBs
NCBI-GeneID: 360768
NCBI-ProteinID: NP_001014148
RGD: 1306410
Ensembl: ENSRNOG00000001032
Vega: OTTRNOG00000001895
UniProt: Q6AYE1
Position
12p11
AA seq 282 aa AA seqDB search
MAAAAAGTGTWAAQEKQFPPALLSFFIYNPRFGPREGEEENKILFYHPNEVEKNEKIRNV
GLCEAIVQFTRTFSPSKPAKSLHTQKNRQFFNEPEENFWMVMVVRNPIIEKQSKDGKAVV
EYQEEELLDKVYSSVLQQCYSMYKLFNGTFLKAMEDGGVKLLKERLEKFFHRYLQTLHLQ
SCDLLDIFGGISFFPLDKMTYLKIQSFINRMEESLSVVKYTAFLYNDQLIWSGLEQDDMR
ILYKYLTTSLFPRHIEPELAGRDSPVRAEMPGNLQHYGSLPH
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagcggcggccgggacagggacttgggcagcccaggaaaagcagttcccgccg
gcgctgttgagcttcttcatctacaacccacgtttcgggccgcgagagggagaggaagaa
aataaaattttgttttaccatccaaatgaagtagaaaagaatgaaaaaattagaaatgtt
ggattatgtgaagcaatcgtacagtttacaaggacttttagcccatcgaaacctgcaaaa
tctttacacacacagaagaatagacagttcttcaatgaaccagaagaaaatttctggatg
gtcatggttgttcggaatcctatcatcgaaaagcagagtaaagatggcaaggcggtagtg
gagtaccaagaggaggaactgttggacaaggtgtatagctcagtgctccagcagtgctac
agcatgtacaagctttttaatgggacgtttctgaaagccatggaagatggaggtgtcaag
ctcctaaaagagagattagagaaattcttccatcggtatttgcagacgctgcatttgcaa
tcatgtgacctcctggatatctttggtgggatcagcttcttcccgttggataaaatgact
tacttgaaaatccagtcctttattaaccgaatggaagaaagcctgagtgtagtcaaatac
acagcattcctgtacaacgaccaactcatctggagtggactagaacaagatgacatgaga
attttgtacaaatacctcaccacctcactgttccccagacacatcgaacctgagttggcg
ggaagggattccccagtaagggcggaaatgccgggaaatcttcaacactacggaagttta
cctcattga

DBGET integrated database retrieval system