KEGG   Rattus norvegicus (rat): 360773Help
Entry
360773            CDS       T01003                                 

Gene name
Sun1, Unc84a
Definition
(RefSeq) Sad1 and UNC84 domain containing 1
  KO
K19347  SUN domain-containing protein 1/2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    360773 (Sun1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   LINC complex
    360773 (Sun1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRP Sad1_UNC Sun2_CC2 JAKMIP_CC3 Fmp27_WPPW
Motif
Other DBs
NCBI-GeneID: 360773
NCBI-ProteinID: NP_001007148
RGD: 1359142
Ensembl: ENSRNOG00000001299
UniProt: Q5U2W0
Position
12q11
AA seq 757 aa AA seqDB search
MDFSRLHTYTPPQCVPENTGYTYALSSSYSSDALDFETEHRLEPVFDSPRMSRRSLRLIT
TTAAYSSGDGQTVDTHISTSRATPAKGRETRTVKQRSASKPAFSINHLSGKGLSSSTSHD
SSCSLRSATVLRHPVLDESLIREQTKVDHFWGLDDDGDLKGGNKAATQGNGELAAEVASS
NGYTCRDCRMLSARTDALTAHSAVHGPTSRVYSRDRTLRPRKAASGTFWWLGSGWYQFVT
LISWLNVFLLTRCLRNICKVFVLLLPLLLLLGAGFSLWGQGNFFSLLPMLNWTAMQPAQR
VDNPKDMHRPGPLSPSPPLKVDPMASQWPQESDMGQKIASLSAQCHNHDERLAELTVLLQ
KLQIRVDQVDDGREGLSLWVKDMVGQHLQEIGSIEPPDAKTDFLTLHHDHEVRLSSLEDV
LRKLTEKSEAIQKELEETKLRAGSRDEEQPLLDRVQHLELELNLLKSQLSDWQHLRSSCE
QADARIQETVQLMFSEDQPGGSLEWLLQKLSSRFVSKDELQVLLHDLELKLLQNITHHIT
VTGQAPTSEAIVSAMSQAGISGITEAQAHIIVNNALRLYSQDKTGMVDFALESGGGSILS
TRCSETYETKTALLSLFGVPLWYFSQSPRVVIQPDIYPGNCWAFKGSQGYLVVRLSMKIY
PTTFTMEHIPKTLSPTGNISSAPRDFAVYGLETEYQEEGQPLGRFTYDQEGDSLQMFHTL
ERPDQGFQIVELRVLSNWGHPEYTCLYRFRVHGEPIQ
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atggacttttctcggctgcacacatacaccccaccccagtgtgtgccagagaacactggc
tatacctacgcactcagttctagttattcttcggatgctctggattttgagactgaacac
agattggaacctgtctttgactctccaaggatgtcccgccgtagcttgcgcctgatcaca
acaacagctgcatacagcagtggggacggccagactgttgacactcacatcagcaccagc
agggccaccccggccaaggggagagaaaccaggacagtcaaacagagaagtgcaagcaag
ccagcttttagtatcaaccacctgtcagggaagggcttgtcctcaagcacaagccatgac
agctcttgcagcctgcggagtgccacggtgctgcggcatcctgtgctagacgagtctctg
attcgtgagcagaccaaagtggaccacttctggggtctcgatgatgatggcgaccttaaa
ggtggaaataaagctgccactcagggaaatggtgaactggcagcagaggtggcgagcagc
aacggatacacctgccgcgactgcaggatgctctcggctcggacagacgctctcacagcc
cactctgccgtccacgggcccacctcaagggtttactccagagataggactctcagaccc
cggaaggcagcctctggaaccttctggtggctagggagtggctggtaccaatttgttact
ttgatttcctggctgaatgtgtttcttcttaccaggtgccttcgaaatatttgcaaggtt
tttgtcttgctgctcccactcctacttttattaggtgctggtttctccttgtggggccag
ggcaacttcttctcactcctaccaatgttgaattggacggccatgcagccagcgcagagg
gtggacaatcccaaggacatgcacagacccggccctctttccccgagtccacctctcaag
gttgatcccatggcttcccagtggcctcaggagagtgatatggggcagaagatagcctct
ttgagtgcacagtgccacaaccatgatgagagactcgcagagctgacagtcctgcttcag
aaactccagatacgggtagaccaagtggatgacggcagggaagggctgtcactgtgggtc
aaggatatggttggacagcacctgcaggagattggctccatagaaccacctgatgctaag
actgacttcctgactttacaccatgaccatgaagtgcgtctctccagtttggaagatgtt
cttagaaaactgactgaaaaatctgaggctatccagaaggagctggaggaaaccaagctg
agagcaggcagcagggatgaagagcagcccctccttgaccgtgtgcagcacctagaactg
gagctgaacctgctgaagtcacagctgtcggactggcagcatctgaggagcagctgtgag
caggctgatgcccgcatccaggagactgtgcagctcatgttctctgaggaccagccgggc
ggctccctcgagtggctgttacagaagctttcttctcggttcgtgagcaaggatgagctg
caggtgcttttgcatgaccttgagctgaaactactgcagaatatcacacaccacatcacc
gtcacaggccaggctccgacatccgaggccattgtgtctgccatgagtcaggcagggatt
tcaggaatcacagaagcgcaagcacatatcattgtgaacaatgctctgaggctgtactcc
caagacaagactgggatggtggactttgctctggagtctggaggtggcagcatcctaagc
actcggtgctctgagacctatgagaccaagacggcactgctgagcctgttcggggtccca
ctgtggtacttctcacagtcacctcgagtggtaatccagcccgacatctacccggggaat
tgctgggcatttaagggttcccaggggtacctggtagttcgcttgtccatgaagatctac
ccaaccacgttcaccatggagcacattccaaagacgctgtcaccgactggtaacatctcc
agtgcccccagagactttgcagtctatggactggaaaccgagtatcaggaagaggggcag
cctctgggacggttcacctatgaccaggaaggggactcactccagatgttccacacactg
gaaagacctgaccaagggttccagatagtagagctccgggttctgtccaactggggccac
cctgagtacacttgcctctaccggttccgagtccacggagagcccatccagtag

DBGET integrated database retrieval system