KEGG   Rattus norvegicus (rat): 360779
Entry
360779            CDS       T01003                                 

Gene name
Lrch4
Definition
(RefSeq) leucine rich repeats and calponin homology domain containing 4
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: LRR_8 CH LRR_4 CAMSAP_CH CRR7
Other DBs
NCBI-GeneID: 360779
NCBI-ProteinID: NP_001121023
RGD: 1306145
Ensembl: ENSRNOG00000001402
UniProt: B2RYH6
Position
12q12
AA seq 686 aa
MAAAVAGPLAAGSEEAAASVSVPGSPGLPGSRSAERALEEAVATGTLNLSNRRLKHFPRG
AARSYDLSDITQADLSRNRFPEVPEAACQLVSLEGLSLYHNCLRCLNPALGNLTALTYLN
LSRNQLSSLPPYICQLPLRVLIISNNKLGALPPDISTLGSLRQLDVSSNELQSLPVELCS
LRSLRDLNVRRNQLSTLPDELGDLPLVRLDFSCNRVSRIPVSFCRLRHLQVILLDSNPLQ
SPPAQICLKGKLHIFKYLTMEAGRRGAALGDLVPSRPPSFSPCPAEDLFPGRRYDGGLDS
GFHSVDSGSKRWSGNESTDDFSELSFRISELAREPRGPRQPREDGSGDGDLEQIDFIDSH
VPGDDEQSAAEVRTQEPLPSELSLAAGDMERPSSSRREEPAGEERRRPDTLHLWQERERR
LQQQSGAWGPSKKDSIPKRGIRATGAGASAPSTQTACNGPPKSSAAQLGVSGEQGAPTLP
STSQDPLPVSGPVTAPVPRPLGSIQRPNSFLFRSSSQSGSSPSSPESVLRPRPFPQILEE
KELISQLRQILESRLQQPLPEDLAEALANGVILCQLANQLRPRSVPFIHVPSPAVPKLSA
LKSRKNVENFLEACRKMGVPEADLCSPSDLLRGTAQGLQTILEAVILAGGKAPVPVQPPS
GLGGFLLFYVVSMLLLYVVYTRLLGS
NT seq 2061 nt   +upstreamnt  +downstreamnt
atggcggcggcggtagcgggcccactcgccgccgggagtgaggaagctgcagcttcagtc
tccgtgccagggtctcctggtctgcccgggagccgtagcgcagaacgagccctagaggaa
gctgtggccaccgggaccctgaacttgtccaaccggcgtttgaagcacttcccccggggc
gcggcccgcagttacgacctgtcagacatcacccaggctgacttgtctcggaaccggttt
cccgaggtgcctgaggcagcttgccagctggtgtccctggaaggcctgagcctctaccac
aattgcctgagatgtctgaacccagccttggggaatctcacagccctcacctacctcaat
ctcagccggaaccagctgtcatcattgccaccctacatctgccagctgccccttcgagtg
cttatcatcagcaacaacaagttaggagccctgcctccagacatcagcaccttaggaagc
ctgcggcagcttgatgtgagcagcaatgagctgcagtccctccccgtggagctgtgtagc
ctccgttccctgcgggatctcaatgttcgaaggaaccagctcagtaccctgcctgatgag
ctgggggaccttcctctggtccgcctggatttctcctgtaaccgtgtttcccgaatccca
gtctccttctgccgcctcaggcacctgcaggtcattctgctggatagcaacccccttcag
agtccccctgcccagatatgcctgaaggggaagcttcacatcttcaagtacttaacaatg
gaagctggccgtcggggagctgccctcggggacctggtcccttcccgccccccaagtttt
agtccctgccctgctgaagatttatttccgggacgtcgttatgatggtggcctggactca
ggcttccatagtgttgacagtggcagcaagaggtggtcaggaaatgagtccacagatgat
ttttcagagctgtctttccggatctcagagctggcccgggagccccgggggcctagacaa
cctagggaagatggctctggtgatggagacttggaacagattgactttattgacagtcac
gttcctggggatgacgagcagagtgcagctgaggttaggacccaggagccgctgccttct
gagttaagccttgcagctggggatatggagaggccatctagcagcaggcgggaggagcct
gcaggggaggagaggcggcgcccagacactttgcacttatggcaggagcgggagcggcgg
ctacagcaacagagtggggcgtgggggccctccaagaaagacagcatcccaaagcggggg
atcagggctactggggcaggtgcctcggccccatccacacagaccgcctgcaatggccca
ccaaagtccagtgctgcccaactgggagtttcaggggagcagggagctcccacactaccc
tccacctcccaggacccccttcctgtatctggaccagtgacagctcctgttcccaggcca
ctgggctccattcagagaccaaacagcttcctcttccgctcctcttctcagagtggctca
agcccttcatctccagagtctgttttgagacctcggccgtttcctcagattctagaggag
aaggagctaatatcacaactccgccagatcctagagtcacggctgcagcaacccctacct
gaggacctggcagaggctctcgccaacggggtcatcctctgccagctggcgaaccagctt
cgaccccgctctgtgcccttcattcatgtgccctcacctgctgtgccaaagctcagtgcc
ctcaagtctcggaagaacgtagagaatttcttagaggcctgtcggaaaatgggtgtgcca
gaggctgacctgtgctcgccctcggatctcctccggggcaccgcccaggggctgcagacc
atcctggaggctgtgatcctggctgggggcaaggcccctgtcccagtccagcccccctct
ggtctgggtggcttcctcctcttctacgtggtctccatgctgctgctctatgtcgtctac
actcggctcctgggctcctag

DBGET integrated database retrieval system