KEGG   Rattus norvegicus (rat): 360785Help
Entry
360785            CDS       T01003                                 

Gene name
Ap1s1, Ube2w
Definition
(RefSeq) adaptor-related protein complex 1, sigma 1 subunit
  KO
K12394  AP-1 complex subunit sigma 1/2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    360785 (Ap1s1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    360785 (Ap1s1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    360785 (Ap1s1)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    360785 (Ap1s1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clat_adaptor_s DEK_C CNOT1_HEAT
Motif
Other DBs
NCBI-GeneID: 360785
NCBI-ProteinID: NP_001101801
RGD: 1305911
Ensembl: ENSRNOG00000001415
UniProt: B5DFI3
Position
12q12
AA seq 158 aa AA seqDB search
MMRFMLLFSRQGKLRLQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYK
RYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMG
GDVQDTSKKSVLKAIEQADLLQEEDESPRSVLEEMGLA
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgattcatgctactgttcagccggcagggaaaacttcggctacaaaaatggtac
ctggccacctcagacaaggagaggaagaaaatggtccgagagctcatgcaggtcgttctg
gctcgaaagcccaaaatgtgcagcttcctggagtggagggacctcaaagttgtctataag
agatatgccagtctctatttctgctgcgccatcgaaggccaagacaatgagctgatcacc
ctggagctgatccaccgatacgtagagctcttggacaagtacttcggcagcgtatgcgag
ttggacatcatcttcaactttgagaaagcgtacttcatcctggatgagtttctgatgggc
ggggacgtccaggacacatccaagaagagtgtcctcaaggctatcgagcaggctgacctg
ctgcaggaggaggatgagtcgccgcgcagtgtcctggaggagatgggcctggcatag

DBGET integrated database retrieval system