KEGG   Rattus norvegicus (rat): 360797Help
Entry
360797            CDS       T01003                                 

Gene name
Rabgef1
Definition
(RefSeq) RAB guanine nucleotide exchange factor 1
  KO
K20131  Rab5 GDP/GTP exchange factor
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    360797 (Rabgef1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    360797 (Rabgef1)
 Protein recycling
   Other Rab GTPase associated proteins
    360797 (Rabgef1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VPS9 DUF5601 zf-A20 SSTK-IP
Motif
Other DBs
NCBI-GeneID: 360797
NCBI-ProteinID: NP_001101803
RGD: 1307295
Ensembl: ENSRNOG00000000895
UniProt: G3V631
Position
12q12
AA seq 502 aa AA seqDB search
MLSHSLVIRKKMSLKSERRGIHVDQSELLCKKGCGYYGNPAWQGFCSKCWREEYHKARQR
QIQEDWELAERLQREEEEAFASSQSSQGAQSLTFSKFEEKKTNEKTRKVTTVKKFFSASS
RAGSKKEIQEAKAPSPSINRQTSIETDRVTKEFIDFLKTFHKTGQEVYKQTKMFLEAMPY
KRDLSIEEQSECTQDFYQNVAERLQTRGKVPPEKVEKMMDQIEKHIMTRLYKFVFCPETT
DDEKKDLAIQKRIRALHWVTPQMLCVPVNEEIPEVSDMVVKAITDIIEMDSKRVPRDKLA
CITRCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPSRLMT
GEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQESESWSPEACLGVKQ
MYKNLDLLSQLNERQERIMTEAKKLEKDLIDWTDGIAKEVQDIVEKYPLEIKPPNQPLAA
IDSENVENDKLPPPLQPQVYAG
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgctttctcactccttggttatcaggaagaagatgagcctgaagtccgaacgccgggga
attcatgtggatcagtcggagctcctgtgcaagaaaggatgtggttattatggaaaccct
gcctggcagggtttctgctccaaatgctggagggaggagtaccacaaggcccggcagagg
cagatccaagaggactgggaactagcagaacgacttcagcgggaggaggaagaggccttc
gctagcagccagagcagccaaggagcccagtccctcaccttctccaagtttgaggagaag
aaaaccaatgagaaaactcgcaaagtcaccacagtgaagaagttcttcagcgcctcttcc
agggctggatccaagaaggaaattcaggaagccaaagctcccagtccctccataaaccgg
cagaccagcattgagacggaccgagtgactaaggagttcatagactttctcaagaccttc
cacaagacaggccaagaagtctataaacagacgaagatgtttttggaagcaatgccttat
aaaagggatttaagcatcgaggaacagtcagaatgtactcaggacttttaccagaatgtg
gcggaaaggttgcagacccgcgggaaagtgcctccagagaaagtggagaagatgatggat
cagatcgaaaagcacatcatgacccgtctctataaatttgtgttctgcccagagacgact
gatgacgagaaaaaagatctcgccattcaaaagaggatcagggctctgcactgggtgaca
cctcagatgctctgtgtcccggtcaatgaggaaatcccggaagtgtctgacatggtggtg
aaagcgatcacagacatcattgagatggactcaaagcgtgtgcctcgggacaagctggcc
tgcatcaccaggtgtagcaagcacatcttcaatgccatcaagatcaccaagaatgagcca
gcctctgccgatgacttcctgcccacccttatctacatcgtcctgaagggcaacccccct
cgtctgcagtccaacatccagtacatcactcgcttctgcaaccccagccggctcatgacg
ggcgaggatggctactacttcaccaacctgtgctgtgctgtggctttcattgagaaacta
gacgctcagtctttgaatttaagtcaggaggattttgaccggtacatgtctggccagacg
tcccccaggaagcaagagtctgagagttggtccccggaggcctgcttaggtgtgaagcaa
atgtataagaacttggacctcctgtctcagctgaatgaacggcaggaaagaatcatgact
gaagccaagaaactcgaaaaagacttaatagactggacagatgggatcgccaaggaagtt
caagacattgttgagaagtaccctcttgagattaagcccccaaaccaacccttagcagcc
attgactctgagaatgtggagaacgacaagctccctccccctctgcagccgcaggtgtat
gcagggtga

DBGET integrated database retrieval system