KEGG   Rattus norvegicus (rat): 360799Help
Entry
360799            CDS       T01003                                 

Gene name
Nupr2, Nupr1l, RGD1560258
Definition
(RefSeq) nuclear protein 2, transcriptional regulator
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Phospho_p8
Motif
Other DBs
NCBI-GeneID: 360799
NCBI-ProteinID: NP_001128042
RGD: 1560258
Ensembl: ENSRNOG00000000917
UniProt: D3ZTS1
Position
12q13
AA seq 103 aa AA seqDB search
MDSPVRPPVSRPRTRGRPPPPPEALPTVGLEEELYDCLDYHYLRDFPASGAGHSKGRTRR
EQQLRTNYTVPGGHERKVAQILLNGQRKRRQRQMQPRPRTRLA
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atggactctccagttcgtcctcctgtctcccgcccacggactcgaggtcgcccgccgccg
ccgccggaggcactgcccactgtcggcttagaagaggagctgtacgattgcctggactac
cactatctgcgtgacttcccggcctccggggctggacacagcaagggccggacgcggcgc
gaacagcagctacgcaccaactacacagtgcccggcggccacgagcgcaaggtggcacag
atactgctcaacgggcaacgcaagcggcgccagcgccagatgcaaccgcggccacgcaca
cgcctcgcatga

DBGET integrated database retrieval system