KEGG   Rattus norvegicus (rat): 360801
Entry
360801            CDS       T01003                                 

Gene name
Ncor2
Definition
(RefSeq) nuclear receptor co-repressor 2
  KO
K06065  nuclear receptor co-repressor 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04330  Notch signaling pathway
rno05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    360801 (Ncor2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    360801 (Ncor2)
SSDB
Motif
Pfam: GPS2_interact Myb_DNA-binding Myb_DNA-bind_6
Other DBs
NCBI-GeneID: 360801
NCBI-ProteinID: NP_001101804
RGD: 1310293
Ensembl: ENSRNOG00000001004
UniProt: D3ZXN9
Position
12q15
AA seq 2472 aa
MSGSTQPVAQTWRAAEPRYPPHGISYPVQIARPHTDVGLLEYQHHPRDYTSHLSPGSIIQ
PQRRRPSLLSEFQPGSERSQELHLRPESRTFLPELGKPDIEFTESKRPRLELLPDTLLRP
APLLATGQPSGSEDLTKDRSLAGKLEPVSPPSPPHADPELELTPSRLSKEELIQNMDRVD
REITMVEQQISKLKKKQQQLEEEAAKPPEPEKPVSPPPIESKHRSLVQIIYDENRKKAEA
AHRILEGLGPQVELPLYNQPSDTRQYHENIKINQAMRKKLILYFKRRNHARKQWEQRFCQ
RYDQLMEAWEKKVERIENNPRRRAKESKVREYYEKQFPEIRKQRELQERMQSRVGQRGSG
LSMSAARSEHEVSEIIDGLSEQENLEKQMRQLAVIPPMLYDADQQRIKFINMNGLMDDPM
KVYKDRQVTNMWSEQERDTFREKFMQHPKNFGLIASFLERKTVAECVLYYYLTKKNENYK
SLVRRSYRRRGKSQQQQQQQQQQQQQQMARSSQEEKEEKEKEKEADKEEEKQDAENEKEE
LSKEKTDDTSGEDNDEKEAVASKGRKTANSQGRRKGRITRSMANEANHEETATPQQSSEL
ASMEMNESSRWTEEEMETAKKGLLEHGRNWSAIARMVGSKTVSQCKNFYFNYKKRQNLDE
ILQQHKLKMEKERNARRKKKKTPAAASEETAFPPAAEDEEMEASGASANEEELAEEAEAS
QASGNEVPRVGECSGPAAVNNSSDTESVPSPRTEATKDAGPKPASTEALPAATQPPVPPP
EEPATVPDEPCPAPDASGPPSPVASPPPAAPPAAVDKDEQDQAATVPQTEDAKEQKSEAE
ELVIDVGKTEEPEAPEEPPESVKSDHKEETEEEPEDKAKGPEAIETVSEAPLKVEEAGSK
AAVTKGSSSGATQDSDSSATCSADEVDEPEGGDKGRLLSPRPSLLTPAGDPRASTSPQKP
LDLKQLKQRAAAIPPIVTKVHEPPREDTVPPKPAPPVPPPTQHLQPEGDVSQQSGGSPRG
KCRSPVPPAEKEAEKASFFPAFPAEGPKLPTEPPRWTSGLPFPIPPREVIKTSPHAADPS
AFSYTPPGHPLPLGLHDSARPVLPRPPISNPPPLISSAKHPGVLERQLGTISQQGMSVQL
RVPHSEHAKAPMGPLTMGLPLAVDPKKLGTALGSTASGSITKGLPSTRTADGPSYRGSIT
HGTPADVLYKGTISRIVGEDSPSRLDRAREDTLPKGHVIYEGKKGHVLSYEGGMSVSQCS
KEDGRSSSGPPHETAAPKRTYDMMEGRVGRTITSASIEGLMGRAIPEQHSPHLKEQHHIR
GSITQGIPRSYVEAQEDYLRREAKLLKREGTPPPPPPPRDLTETYKTRPLDPLGPLKLKP
THEGVVATVKEAGRSIHEIPREELRRTPELPLAPRPLKEGSITQGTPLKYDSGVPSSGSK
KHDVRSIIGSPGRPFPALHPLDIMADARALERACYEESLKSRSGTSSGAGGSITRGAPVV
VPELGKPRQSPLAYEDHGAPFTSHLPRGSPVTTREPTPRLQEGSLLSSKASQDRKLTSTP
REIAKSPHSTVPEHHPHPISPYEHLLRGVTGVDLYRGHIPLAFDPTSIPRGIPLEAAAAA
YYLPRHLAPSPTYPHLYPPYLIRGYPDTAALENRQTIINDYITSQQMHHNAASAMAQRAD
MLRGLSPRESSLALNYAAGPRGIIDLSQVPHLPVLVPPTPGTPATAIDRLAYLPTAPPPF
SSRHSSSPLSPGGPTHLAKPTATSSSERERERERERDKSILTSTTTVEHAPIWRPGTEQS
SGAGGSSRPASHTHQHSPISPRTQDALQQRPSVLHNTSMKGVVTSVEPGTPTVLRWARST
STSSPVRPAATFPPATHCPLGGTLEGVYPTLMEPVLLPKETSRVTRPERPRVDAGHAFLT
KPPAREPASSPSKSSEPRSLAPPSSSHTAIARTPAKSLAPHHASPDLPAPTSASDLHREK
TQSKPFSIQELELRSLGYHSGAGYSPDGVEPISPVSSPSLTHDKGLSKPLEELEKSHLEG
ELRHKQPGPMKLSGEAAHLPHLRPLPESQPSSSPLLQTAPGIKGHQRVVTLAQHISEVIT
QDYTRHHPQQLSGPLPAPLYSFPGASCPVLDLRRPPSDLYLPPPDHGTPARGSPHSEGGK
RSPEPSKTVLSSSEDAIEPVSPPEGMTEPGHARSTAYPLLYRDGEQGEPRMGSKSPGNTS
QPPAFFSKLTESNSAMVKSKKQEINKKLNTHNRNEPEYNIGQPGTEIFNMPAITGAGLMT
CRSQAVQEHASTNMGLEAIIRKALMGKYDQWEEPPPLGANAFNPLNASASLPAAAMPITT
ADGRSDHPLTSPGGGGKAKVSGRPSSRKAKSPAPGLAPGDRPPSVSSVHSEGDCNRRTPL
TNRVWEDRPSSAGSTPFPYNPLIMRLQAGVMASPPPPGLAAGSGPLAGPHHAWDEEPKPL
LCSQYETLSDSE
NT seq 7419 nt   +upstreamnt  +downstreamnt
atgtcaggatccacacagcctgtggcacagacatggcgggctgctgagccccgctaccca
ccccatggcatctcctacccggtgcagatagcccggccccacacggacgtggggctgctt
gagtaccaacaccaccctcgtgactacacctcacacctgtcacccggctccattatccag
ccacagaggaggcggccctcactgctatctgagttccagcctggaagtgaacggtctcag
gagctccacctgcgccctgagtctcgcaccttcctgcctgaactgggcaagcccgacata
gaattcacagagagcaagcgcccacgcctggagctactacctgataccctgctgcgcccg
gcacccctgctggccactgggcagccaagtgggtctgaagatcttaccaaggaccgcagc
ctggcaggcaagctggagcccgtgtcacctcccagcccaccacacgctgaccctgagcta
gagctgacgccatctcggctgtccaaggaggagctgatccagaacatggaccgtgtggac
cgtgagatcaccatggtggagcagcagatctccaagctgaagaagaagcagcaacagttg
gaggaggaggccgccaagccacccgagcccgagaagccggtgtcgccaccacccatagaa
tcaaagcaccgcagtctggtccagatcatctacgacgagaaccggaagaaagccgaagct
gcacaccgcatcctggaagggctggggccccaggtggagctgcctctgtacaaccagccg
tccgacacacgccagtaccatgagaacatcaaaataaaccaggcgatgcggaagaagctg
atcttgtacttcaagcggaggaaccacgcacgcaagcagtgggagcagcgcttctgccag
cgctatgaccagctcatggaggcatgggagaagaaggtggagcgcattgagaacaatccg
cggagaagggccaaggagagcaaggtgagggagtactacgagaaacagttcccggagatc
cgcaagcagcgggagctgcaggagcgcatgcagagcagggtgggccagcgtggcagtggg
ctctccatgtcggcggcacgcagtgagcatgaggtttctgagatcatcgatggcttgtct
gagcaggagaacctggagaagcagatgcgccagctggctgtgatcccgcccatgttgtac
gatgcggaccagcagaggatcaagttcatcaacatgaacggactcatggacgaccccatg
aaggtgtacaaagaccgccaggttaccaacatgtggagtgagcaggagagggacaccttc
cgcgagaagttcatgcagcatcccaagaactttggcctgatcgcctcattcctggagaga
aagacagtagccgagtgtgtcctctattactacctgaccaagaagaatgagaactacaag
agcttggtgaggcgcagctatcggcgccgtggcaagagtcagcagcaacagcagcagcaa
cagcagcagcagcagcagcagatggcacggagcagccaggaggagaaggaggagaaggag
aaggagaaggaagccgacaaggaggaggagaagcaggatgcggagaacgagaaggaagaa
ctcagcaaggagaagacagacgacacttctggagaggacaacgatgagaaagaggctgtg
gcctccaaaggccgcaaaactgccaacagccaaggccgccgcaaaggccggatcacacgc
tccatggccaacgaggccaaccatgaggagacggccaccccgcagcaaagttcagagcta
gcttccatggagatgaacgagagctctcgctggactgaggaagagatggagacagcaaag
aaaggcctcctggaacatgggaggaactggtcagccatcgcccgcatggtgggctccaag
actgtgtcccagtgtaagaacttttacttcaactacaagaagaggcagaacctggacgaa
atccttcagcagcacaagctaaagatggagaaggagaggaatgcccggaggaagaaaaag
aagaccccggctgcggcaagtgaggagacagccttcccacctgccgctgaggacgaagag
atggaggcgtctggtgcaagtgccaatgaggaagaactggcggaggaggcagaagcctca
caggcctccgggaatgaggttcccagagttggagagtgcagtggcccagctgctgtcaac
aacagctctgatactgagagtgtcccatccccgcgcacggaagccaccaaggacgctggt
cctaagcctgctagcactgaagcattgcccgctgccacccagccacctgttcctcctcca
gaagaacccgcaacagtccctgatgagccctgcccagcccctgatgccagtggcccacca
tccccagtggcttccccaccacctgccgcacccccggctgctgttgacaaggatgaacaa
gaccaggctgctactgttccccagaccgaggatgccaaggagcagaagtctgaggccgag
gagctggtgattgatgtgggaaagacagaggaacccgaggcccctgaggagccaccagag
agtgtaaagagtgatcacaaggaggagactgaggaggagcctgaagacaaagccaagggc
ccagaggccattgagactgtgtccgaggcgccacttaaggtggaggaggctggaagcaag
gcagctgtgaccaagggttccagctcgggtgccacccaggacagtgactccagtgccacc
tgcagtgccgatgaggtggatgagcccgagggaggtgacaagggcaggctgctgtcacca
aggcccagcctcctcaccccagccggagatccccgggccagtacctcgccccagaagccg
ctggacctgaagcagctgaagcagcgagcagcagccatcccccctattgtcaccaaggtc
catgaacccccccgggaggacacagtacccccaaagccagctccccctgtgcctccaccc
acgcagcacctacagccagagggtgacgtgtctcagcagtcgggaggaagtccacgtggc
aagtgccgcagcccggtgcctcccgccgagaaagaggcagagaaagcttcattctttccc
gccttcccagctgagggcccgaagcttcctactgagcccccacgctggacatcgggtctg
ccttttcccattcctcctcgggaagtgatcaagacttccccacacgctgcagacccctct
gccttctcctacacaccccctggtcaccctctgcctctgggcctccacgatagtgcccgg
ccggtcctgccacgtccccccatctctaaccccccacccctcatctcctctgccaagcac
cctggtgtacttgagaggcagctgggtaccatctcccagcagggaatgtcagtgcagctt
cgcgtgccccactcagagcatgccaaggcccccatgggccctctcaccatgggactgcct
ctcgctgtggaccctaagaagctggggacagcactgggctccactgccagtggaagcatc
accaagggcctccccagtacccggactgcagatggccccagctaccgaggctctatcacc
cacggcacgccagcagacgtcctctacaagggtaccatcagcaggatcgttggtgaggac
agcccaagtcgccttgatcgggcacgagaggataccctgcccaagggccatgtcatctat
gagggcaagaaaggccatgtcctatcctatgaaggtggtatgtcggtgtcacagtgctcc
aaggaggatgggaggagcagctcaggcccaccccacgagactgccgcccctaaacgcacc
tatgacatgatggagggccgtgtgggcaggaccatcacctcagccagcatcgagggactc
atgggccgtgccatccctgagcagcacagcccccacctcaaggagcaacatcacatccga
ggctccatcacgcaaggcatcccgaggtcatatgtggaggcccaggaggactacttacgt
agggaggccaagctcttgaagcgagaaggcacgccaccgcccccaccgccacctcgggac
ctgactgagacctacaagacccggcccctcgaccctctgggtcccctgaagctgaagcca
actcatgagggtgtggtagcgactgtgaaggaggcgggccgctctatccatgagatccca
cgagaggagctgcgccgcacgcccgagctgcccctggcaccacggcctctgaaggagggt
tccatcacccaggggaccccactcaagtacgactccggggtgccctccagtggctccaag
aaacacgacgtacgctccatcatcggcagccccggccggccttttcctgccctgcaccca
ctggacataatggctgatgcccgggcactagagcgcgcctgctatgaagagagtctgaag
agccggtcagggaccagcagtggtgcagggggctccatcacacgcggggccccagttgtc
gtgcctgagctaggcaagccccggcaaagcccactggcctacgaggaccacggggcaccc
ttcaccagccacctgccccgaggctcacctgtgactaccagggagcccacgccacgcctt
caggaaggcagcctcctctccagcaaggcgtcccaggaccggaagctgacctcgacaccc
cgggagattgccaagtccccacatagcactgtgcccgagcaccacccccaccccatctcc
ccctacgagcacctgctccggggtgtgactggtgtggacctgtaccgtggccacatccca
ttggcctttgaccccacctccataccccgagggatccctctggaagcagcagccgcagcc
tactacctgccccggcacttggcccccagccccacctacccacacctgtacccgccttac
ctcatccgcggctaccctgacaccgcggccctggagaaccgccagaccatcatcaatgac
tacatcacctcgcagcagatgcaccacaacgcagcctctgccatggcccagcgcgccgat
atgctgaggggtctgtcaccgagagagtcctcgctggccctcaattatgccgctggcccg
cgtggcattatcgacctgtcccaagtgccacacctgcccgtgctggtgccgccaactcca
ggcacccctgccaccgccatcgaccgccttgcctacctccccactgcgcccccacccttc
agcagccgtcacagcagttcaccactgtccccaggaggccccactcacctagctaaacca
actgccacgtcatcatcggagcgggaacgggaacgagagcgagaacgagacaagtccatc
ctcacgtccaccactacagtggagcatgcacccatctggagacctggtacggagcagagc
agcggggctgggggcagcagccgccccgcctcccacacccaccagcactcgcccatctcc
ccccggacccaggacgccttgcagcagaggcccagtgtgctgcacaacacgagcatgaag
ggcgtggtcacctccgtggaacccggcacgcccacggtcctgaggtgggccaggtccacc
tccacctcttcacctgtccgcccagctgccacattcccacctgccacccactgcccactt
ggtggcaccctcgaaggggtctaccctaccctcatggagccagtcctgttacccaaggag
acctctcgggttacccggcctgagcggccccgtgtggacgctggccatgccttcctcacc
aagcccccagcccgggagcctgcctcctcacccagcaagagctccgaaccccgatcccta
gcaccccccagctccagccacacagccatcgcccgcaccccagcaaagagccttgcaccc
caccatgccagtccggacctgccggcgcccacctcggcctcagatctgcaccgagaaaag
actcaaagtaaacccttttccatccaggaattggaactccgttctctgggttaccacagt
ggagctggctacagccctgatggggtagagcccatcagccccgtgagctcgcccagcctg
acccacgacaaggggctctccaagcctctggaagagctagagaagagccacttggagggg
gagctgcggcacaagcagccaggccccatgaagctcagtggggaggctgcccacctccca
catctgcggccactgccggagagccagccctcatccagcccactcctccagactgcccca
ggcatcaaaggtcaccagagggtggtcaccttggctcagcacatcagtgaggtcattaca
caggactacacacgccaccacccacagcagctcagtggcccccttcccgcccctctctac
tccttccctggagccagctgccctgtcctggatctccgccgtccacccagtgacctctac
ctcccacccccggaccatggcaccccagcccggggatccccccacagtgaagggggcaaa
aggtctccagaacccagcaaaacagtcctgagtagcagcgaggatgctattgaacctgtg
tccccaccggagggcatgactgagccaggacatgcacggagcactgcgtacccactgctg
taccgggacggggagcagggggagcccaggatgggttctaagtctccaggcaacaccagc
cagccgccagccttcttcagtaagctgaccgagagcaactccgccatggtgaagtcgaag
aagcaggagatcaacaagaaactcaacacccataaccggaatgagcctgaatacaatatc
ggccagcctgggacggaaatcttcaacatgcccgccatcactggagcaggccttatgacc
tgtagaagccaggcggtgcaagaacacgccagcaccaacatggggctagaggccattatt
agaaaggcactcatgggtaaatatgatcagtgggaagagcccccgccgctcggcgccaat
gcttttaaccctctgaatgccagtgccagtctgcccgctgccgctatgcccataaccact
gctgacggacggagtgaccacccactcacctcgccaggtggtggtgggaaagccaaggtt
tctggcagacccagcagccgaaaagccaagtcgccagcgccaggcctggcacccggagac
cgaccaccttctgtctcctcagtacactcggagggcgactgcaatcgccgaacaccactc
accaaccgtgtgtgggaggaccggccctcatctgcagggtccacgccattcccctacaac
cctttgattatgaggctacaggcaggtgtcatggcctccccacccccacctggccttgcc
gcaggcagcgggcccctagctggtccccaccatgcctgggatgaggagcccaagccactg
ctgtgttcacagtacgagacactctcggacagcgagtga

DBGET integrated database retrieval system