KEGG   Rattus norvegicus (rat): 360804
Entry
360804            CDS       T01003                                 

Gene name
Cdk2ap1
Definition
(RefSeq) cyclin-dependent kinase 2 associated protein 1
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: CDK2AP DUF4248
Other DBs
NCBI-GeneID: 360804
NCBI-ProteinID: NP_001107223
RGD: 1308664
Ensembl: ENSRNOG00000001070
UniProt: B0BN48
Position
12q15
AA seq 114 aa
MSYKPNLTAHMPAAALNAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQS
KYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARSLVRECLAETERNARS
NT seq 345 nt   +upstreamnt  +downstreamnt
atgtcgtacaagccgaacttgaccgcgcacatgcccgccgccgccctcaacgccgggagt
gtccattcaccgtctactagcatggcgacctcctcccagtatcgccagctgctgagtgac
tatgggcctccatcgctaggctacacccagggaactggaaatagccaggtgcctcagagt
aaatatgcagagctgctggccatcattgaagagttggggaaagagatcagacccacgtat
gcagggagcaagagtgccatggagaggctaaaacgaggcatcattcatgcccgaagcctg
gttcgggagtgcttggctgaaacggaacggaacgccaggtcctag

DBGET integrated database retrieval system