KEGG   Rattus norvegicus (rat): 360818
Entry
360818            CDS       T01003                                 

Gene name
Fbxo21
Definition
(RefSeq) F-box protein 21
  KO
K10301  F-box protein 21
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    360818 (Fbxo21)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     360818 (Fbxo21)
SSDB
Motif
Pfam: Transglut_core2 YccV-like F-box-like F-box_4 F-box
Other DBs
NCBI-GeneID: 360818
NCBI-ProteinID: NP_001101808
RGD: 1307346
Ensembl: ENSRNOG00000001129
UniProt: B0BNL1
Position
12q16
AA seq 620 aa
MAAVAGDSAMEVVPALAEEAAAEASGPSCLVQLPGEVLEYILCSGSLTALDIGRVSSTCR
RLREVCQSSGQVWKEQFRVRWPSLMKHYSPTDYVNWLEEYKVRQKAGLEARKIVASFSKR
FFSEHVPCNGFSDIENLEGPEIFFEDELVCILNMEGRKALTWKYYAKKILYYLRQQKILN
NLKAFLQQPDDYESYLEGAVYIDQYCNPLSDISLRDIQAQIHSIVELVCKTLRGINSRHP
SLTFRAGESSMIMEIELQSQVLDAINYVLYDQLKFKGNRMDYYNALNLYMHQVLTRRTGI
PISMSLLYLTIARQLGVPLEPVNFPSHFLLRWCQGAEGATLDIFDYIYIDAFGKGKQLTV
KECEYLIGQHVTAALYGVVNVKKVLQRMVGNLLSLGKREGIDQSYQLLRDSLDLYLAMYP
DQVQLLLLQARLYFHLGIWPEKVLDILQHIQTLDPGQHGAVGYLVQHTLEHIERKKEEVG
VEVKLRSEEKHRDVCYSIGLVMKHKRYGYNCVIYGWDPTCMMGHEWIRNMNVHSLPHGHH
QPFYNVLVEDGSCRYAAQENLEYNVEPQEISHPDVGRYFSEFTGTHYIPNAELEIRYPED
LEFVYETVQNIYSAKEDTAE
NT seq 1863 nt   +upstreamnt  +downstreamnt
atggcggcggtagcgggggacagcgctatggaggtggtcccggcgctggctgaagaggcc
gcggccgaggcgtcgggccccagctgcctggtgcaactgccaggcgaggtgctggagtac
atcctgtgcagcggctcgctcacggcgctcgacatcggccgcgtgtccagcacctgccgc
cgcctgcgcgaggtgtgccagagcagcgggcaggtgtggaaggagcagttccgggtgagg
tggccctctctgatgaagcactacagtcccactgactacgtcaattggttagaggaatat
aaagttcggcagaaagctgggttagaagcccggaagattgtagcctccttctccaaacgg
ttcttttcagagcacgttccttgtaacggcttcagtgacattgagaaccttgagggccca
gagatcttttttgaggatgaactggtgtgcatcctaaacatggaaggaaggaaagctctg
acctggaagtactacgctaagaagattctctactacctgcggcagcagaaaatcctcaac
aacctcaaggctttcctgcagcagccagatgactacgagtcctatcttgaaggtgccgtt
tacatcgaccagtactgcaacccgctctccgacatcagcctcagagacatccaggcccag
atccacagcatcgtggagcttgtgtgcaaaaccctccgtggcatcaacagtcgtcacccg
agcctgaccttcagggcaggcgagtcctctatgataatggagatagaactccagagccaa
gtgctggacgccatcaactatgtcctgtacgaccagctcaagttcaaagggaaccgcatg
gactactacaatgccttgaacctctacatgcaccaggtattgactcgcagaacgggaatc
cccatcagcatgtctctgctctacctgaccatcgcccggcagctgggcgtccctctggag
cctgtcaacttcccaagccacttcctgctgaggtggtgccaaggcgcagaaggggcaacc
ctggacatcttcgactacatctacatagatgcttttgggaagggcaagcaactgacagtg
aaagagtgtgagtacttgattggccagcacgtgacggcagctctctatggcgtggtgaac
gtgaagaaggtgctgcagcggatggtgggcaacctgctgagcctgggcaagagggaaggc
attgaccagtcctaccagctcctcagagactccttggacctgtacctggcgatgtacccg
gaccaggtgcagctcctgctcctgcaagccaggctctacttccacctgggcatctggcca
gagaaggtgcttgacatcctccagcacatccagaccctcgaccccgggcagcacggggcg
gtggggtatctagtgcagcacacgctagagcacattgagcgcaagaaggaggaggtgggc
gtggaggtgaagctgcgctccgaggagaagcacagggatgtctgctactccatcgggctc
gttatgaagcacaagaggtacggctacaactgtgtgatctacggctgggaccccacgtgc
atgatggggcacgagtggatccgaaacatgaatgtgcacagtctgcctcacggccaccat
cagcccttctacaatgtgctggtggaggacggctcctgcagatacgcagctcaagaaaac
ctggaatacaacgtggagcctcaggaaatctcgcacccagatgtggggcgctacttctcg
gagttcacgggcacacactacatcccaaatgcagagctggagatccggtaccccgaggac
ctggagtttgtgtatgagacagtgcagaacatttacagtgcaaaggaggacacagccgag
tag

DBGET integrated database retrieval system