KEGG   Rattus norvegicus (rat): 360820
Entry
360820            CDS       T01003                                 

Gene name
Pxn
Definition
(RefSeq) paxillin
  KO
K05760  paxillin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04062  Chemokine signaling pathway
rno04370  VEGF signaling pathway
rno04510  Focal adhesion
rno04670  Leukocyte transendothelial migration
rno04810  Regulation of actin cytoskeleton
rno05100  Bacterial invasion of epithelial cells
rno05135  Yersinia infection
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    360820 (Pxn)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    360820 (Pxn)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    360820 (Pxn)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    360820 (Pxn)
   04062 Chemokine signaling pathway
    360820 (Pxn)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    360820 (Pxn)
   05203 Viral carcinogenesis
    360820 (Pxn)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    360820 (Pxn)
   05100 Bacterial invasion of epithelial cells
    360820 (Pxn)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    360820 (Pxn)
   05163 Human cytomegalovirus infection
    360820 (Pxn)
   05165 Human papillomavirus infection
    360820 (Pxn)
SSDB
Motif
Pfam: Paxillin LIM
Other DBs
NCBI-GeneID: 360820
NCBI-ProteinID: NP_001012147
RGD: 1305759
Ensembl: ENSRNOG00000001149
UniProt: Q66H76
Position
12q16
AA seq 586 aa
MDDLDALLADLESTTSHISKRPVFLSEEPPYSYPTGNHTYQEIAVPPPVPPPPSSEALNG
TVLDPLDQWQPSGSRYAHQQPPSPSPIYSSSTKNSSASNPQDSVGSLCSRAGEEEHVYSF
PNKQKSAEPSPTVMSSSLGSNLSELDRLLLELNAVQRSPSGFSAGMVSVQASREPLGSWG
TEGRAIILSPFFQDEAESSPPLPGALSPLYGVPESNNLLGGKAGPLMKEKPKRNGGRGLE
DVRPSVESLLDELENSVPSPVPAITVNQGEMSSPQRVTSSQQQTRISASSATRELDELMA
SLSDFKFMAQGKTGSSSPPGGLSKPGSQLDSMLGSLQSDLNKLGVATVAKGVCGACKKPI
AGQVVTAMGKTWHPEHFVCTHCQEEIGSRNFFERDGQPYCEKDYHSLFSPRCYYCNGPIL
DKVVTALDRTWHPEHFFCAQCGAFFGPEGFHEKDGKAYCRKDYFDMFAPKCGGCARAILE
NYISALNTLWHPECFVCRECFTPFVNGSFFEHDGQPYCEVHYHERRGSLCSGCQKPITGR
CITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQSCFLKLFC
NT seq 1761 nt   +upstreamnt  +downstreamnt
atggacgacctcgacgccctgctggcagacttggagtccaccacctcccacatctccaaa
cggccagtgttcttgtcagaggagcccccctactcctacccaactggaaaccacacttac
caggagattgcagtgccacctccggtcccaccgcccccatccagcgaggccctcaatggc
acagtcctggaccccttagaccaatggcagcctagtggttccagatacgctcaccagcag
cctccatccccatcgcccatatacagctccagcaccaaaaattccagtgcctccaaccct
caggacagtgtcggctccctttgttcccgagcaggcgaggaggaacacgtctacagcttc
cccaacaagcagaagtcagcagagccgtcacccaccgtgatgagctcctccctgggcagc
aacctctctgagctggaccggctgttactggagctgaacgcagtgcagcgtagtccttcc
ggcttctctgcaggtatggtgtcagtccaggcctctcgtgagcctttgggttcctggggg
acggagggacgagcaatcattttgtccccttttttccaagatgaagcagaatcgagcccc
ccattgcccggtgccctgagtcccctttatggcgtcccggagagtaacaatctcctgggg
ggcaaagcagggccgctcatgaaggagaagccaaagcgaaacggaggccgggggctggag
gatgtgcggcccagtgtggagagcctcttggatgagctggagaactctgtgcccagcccc
gtcccggccatcactgtgaaccagggagagatgagcagtccacagcgagtcacctccagc
cagcagcagaccagaatctcagcctcctctgccaccagggagctggacgagctcatggct
tcattgtcagatttcaagttcatggcccaggggaaaaccgggagcagctcgcctcctggg
ggcctctcaaaacctgggagccagcttgacagcatgttggggagtctgcagtccgacctg
aacaagctaggggtcgccaccgttgccaaaggggtttgtggagcctgcaagaagcccatt
gctgggcaggtggtgactgccatggggaagacatggcaccccgagcactttgtgtgcacc
cactgccaggaagagattggatcccggaacttcttcgagcgggacggacaaccctactgt
gaaaaggactaccacagcctcttctccccacgctgctactactgcaacgggcccatcttg
gataaagtggtgacagcgctggaccgcacgtggcacccggaacacttcttctgtgcccag
tgtggagccttctttggtccagaagggttccacgagaaagatggcaaagcctactgtcgg
aaggattacttcgacatgttcgcgcccaagtgtggcggctgtgcccgtgccatcctggag
aactacatctcggccctcaacaccctctggcaccctgaatgctttgtgtgcagggagtgc
ttcacacccttcgtcaatggcagcttcttcgagcacgacgggcagccatattgtgaggtg
cactaccacgagcgtcgcggctcactgtgctccggctgccagaagcccatcaccggccgc
tgcatcaccgccatggccaagaagttccaccccgagcatttcgtgtgcgccttttgcctc
aagcagctcaacaagggcactttcaaggagcagaacgacaagccctactgtcagagctgc
ttcctgaagctcttctgttag

DBGET integrated database retrieval system