KEGG   Rattus norvegicus (rat): 360843
Entry
360843            CDS       T01003                                 

Gene name
Etnk2, EKI_2
Definition
(RefSeq) ethanolamine kinase 2
  KO
K00894  ethanolamine kinase [EC:2.7.1.82]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00564  Glycerophospholipid metabolism
rno01100  Metabolic pathways
Module
rno_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    360843 (Etnk2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.82  ethanolamine kinase
     360843 (Etnk2)
SSDB
Motif
Pfam: Choline_kinase
Other DBs
NCBI-GeneID: 360843
NCBI-ProteinID: NP_001101813
RGD: 1305304
Ensembl: ENSRNOG00000028368
Vega: OTTRNOG00000000635
UniProt: D3ZRW8
Position
13q13
AA seq 163 aa
MEEKAVASASCWEPPGPPRAAVPCFAIAVDQDDILPGALRLIRELRPHWKPEQVRTKRFK
DGITNKLLACYVEEDMRDCVLVRVYGEWTELLVDRENEIRNFQLLRAHGCAPKLYCTFQN
GLCYEYMQGVALGPEHIREPQLFRSPPRVPARSLQRRGTETWE
NT seq 492 nt   +upstreamnt  +downstreamnt
atggaggagaaggcggtggccagcgccagttgctgggagcctccaggccccccgagggcc
gccgtcccgtgcttcgccatcgcagtggaccaggacgacatcctccccggtgctctgcgc
cttatccgggagctgcggccgcactggaagcccgaacaagttcggaccaagcgtttcaaa
gatggcatcaccaacaagctattggcctgctatgtggaggaagacatgcgggactgcgtg
ctggtccgggtgtacggggagtggacagagttgctggtggaccgggagaatgagatcaga
aacttccaactgctgcgagcgcacggctgcgcccccaaactctactgtacctttcagaac
gggctatgctacgagtacatgcagggtgtggccctgggaccagagcatatccgagagccc
cagctcttcaggtcccctcctcgtgttcctgctaggtccctgcagaggagagggacagag
acctgggagtag

DBGET integrated database retrieval system