KEGG   Rattus norvegicus (rat): 360850Help
Entry
360850            CDS       T01003                                 

Gene name
Nek7
Definition
(RefSeq) NIMA-related kinase 7
  KO
K20876  NIMA (never in mitosis gene a)-related kinase 7 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    360850 (Nek7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    360850 (Nek7)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    360850 (Nek7)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     360850 (Nek7)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  NEK family
   360850 (Nek7)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    360850 (Nek7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Pkinase_fungal Kdo PIP49_C APH Gln_deamidase_2
Motif
Other DBs
NCBI-GeneID: 360850
NCBI-ProteinID: NP_001101816
RGD: 1311160
Ensembl: ENSRNOG00000000657
UniProt: D3ZBE5
Position
13q13
AA seq 302 aa AA seqDB search
MDEQPQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYRASCLLDGVPV
ALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLS
RMIKHFKKQKRLIPERTVWKYFVQLCSALDHMHSRRVMHRDIKPANVFITATGVVKLGDL
GLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDK
MNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNICINPDPEKRPDIAYVYDVAKRMHACTA
SS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggatgaacaaccacaaggaatgcaagggccccctgttcctcagttccagccgcagaag
gcattacgaccagatatgggctataatactttagccaacttccgaatagaaaagaaaatt
ggacgtggacaatttagtgaagtttatagagcatcctgtctcctggatggagttccagta
gctttaaaaaaagtgcagatatttgatttaatggatgccaaagcacgtgccgattgtatc
aaagaaatagatctccttaagcaactcaaccatccaaatgtaattaaatattatgcatca
ttcattgaagataatgagctgaacatagttttggagttagcagatgctggtgacctctcc
agaatgataaagcactttaagaaacaaaagaggctaatccctgagaggactgtttggaaa
tacttcgttcagctctgcagtgcactggaccacatgcattctcgaagagtcatgcacaga
gatataaaaccagctaatgtgttcattacagccactggggtagtcaaacttggagatctt
ggacttggtcggttcttcagctccaaaaccacagctgcacattctttagtgggcacgcct
tactacatgtctccagagaggatccatgagaacggatacaacttcaagtctgacatctgg
tctctcggctgtctgctgtatgagatggcggcgttgcagagtcctttctacggagacaag
atgaatctgtactctctgtgtaagaagatagaacagtgtgactacccacctctcccatca
gatcactattccgaggagctccgacagttagttaatatatgcatcaacccagatccggag
aagcgaccggacatcgcctacgtttatgatgtggcaaagaggatgcatgcctgtaccgcc
agcagctaa

DBGET integrated database retrieval system