KEGG   Rattus norvegicus (rat): 360864Help
Entry
360864            CDS       T01003                                 

Gene name
RGD1309106
Definition
(RefSeq) similar to hypothetical protein
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4548
Motif
Other DBs
NCBI-GeneID: 360864
NCBI-ProteinID: NP_001014152
RGD: 1309106
Ensembl: ENSRNOG00000026523
Vega: OTTRNOG00000000201
UniProt: Q5XIU7
Position
13q22
AA seq 199 aa AA seqDB search
MEKRELKTFVPKFDKIPWLSEASVVNKPLILSIPRRYRSSIVLTSYKKDMYLPHLLEDSD
FISKARKNEHENLLPRNKQLCSTCRGYQEMKTLQPKIFKIPDHREPSPQNSVNHGEVSLH
SQEQQLHACNDIPTESIRYRLPILGPRTAVFHRLLSDAYKTPQDTQYCAFPKKKGMSKTV
KQITTPHAALYPCRSYSAI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggagaagagagagctaaagacttttgttccaaaatttgacaagattccttggcttagt
gaggccagcgtggtaaacaagccgttaatactcagcatccctagaaggtaccgctcctcc
attgttctgacttcatacaagaaggatatgtatttgccacacttgcttgaagattcagac
ttcatatcgaaggctagaaagaacgagcatgaaaacctgttacccagaaacaagcagctg
tgctccacatgtcgaggatatcaagaaatgaaaacgttacagccaaaaattttcaaaata
cctgaccatcgggaaccatccccccagaattctgtgaatcacggcgaggtgagccttcat
tcgcaagagcagcagttacatgcctgcaatgatattccaacagagagcattcgctacagg
ctgcccattttaggccccaggactgctgttttccacaggctgctgtcagatgcctacaaa
actcctcaggatactcaatactgtgcctttcccaaaaagaaaggaatgagcaagacagtg
aaacagataacaacacctcatgctgcactgtatccctgcaggagctactcggctatttga

DBGET integrated database retrieval system