KEGG   Rattus norvegicus (rat): 360871Help
Entry
360871            CDS       T01003                                 

Gene name
Mpzl1
Definition
(RefSeq) myelin protein zero-like 1
  KO
K06770  myelin protein zero
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    360871 (Mpzl1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rno04515]
    360871 (Mpzl1)
Cell adhesion molecules [BR:rno04515]
 Immunoglobulin superfamily
  P0
   360871 (Mpzl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_3 ig TraL Ig_2 I-set Syndecan Adeno_E3_CR2 MDM31_MDM32
Motif
Other DBs
NCBI-GeneID: 360871
NCBI-ProteinID: NP_001007729
RGD: 1359140
Ensembl: ENSRNOG00000003248
UniProt: Q6AYT8
Position
13q23
AA seq 270 aa AA seqDB search
MAEAVGAVTLIAAPARRRWLWSALAAMLGLLTARISALEVHTPKEIFVVNGTQGKLTCTF
DSPNTTGWLTTVSWSFQPEGTDSAVSFFHYSQGQVYIGDYPPFKDRVTWAGDLDKKDASI
NIENIQAVHNGTYICDVKNPPDIVVRPGQIRLHVVEIDNLLVFLVWVVVGTVTAVVLGLT
LLISLVLVVLYRRKHSKRDYTGCSTSERLSPVKQAPRKCPSDTEGLVKSPPSAGSHQGPV
IYAQLDHSGGHHSGKINKSESVVYADIRKD
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggccgtcggagccgtgacattgattgcggccccggcccgccggcgctggctg
tggtcggcgctagccgcgatgctcgggctgttgacagctagaatatcagccttggaggta
catactcctaaagaaatctttgtggtgaatgggacacaagggaagctcacgtgcacgttt
gactctcctaatacaactgggtggttgaccaccgtctcctggagcttccagccagaaggc
accgacagcgccgtgtcgtttttccactactcacaaggacaagtgtacatcggggattat
ccaccgtttaaagaccgagtcacctgggctggggaccttgacaagaaagatgcatcgatc
aatatagaaaacattcaggctgttcacaatggcacctatatctgcgatgtcaaaaaccct
cctgacattgttgtgcggcctgggcagattaggctccatgtggtggaaatagacaacctg
ctggtgttcctggtttgggtggtggtgggcactgtcactgctgtggtccttgggctcact
ctactcatcagcttggtcctggtcgtcctctacagacggaagcattcgaagcgggattat
accggctgcagtacctcagagcgtttgtcaccagttaagcaggctccacggaagtgtccc
tccgacacagagggtctagtaaagagtccgccttccgccggatctcaccagggcccagtc
atatacgcacagttagaccactctggcggacatcacagtggcaagattaataagtcagag
tctgttgtgtatgcggacatccggaaagactaa

DBGET integrated database retrieval system