KEGG   Rattus norvegicus (rat): 360886Help
Entry
360886            CDS       T01003                                 

Gene name
Ahctf1, ELYS, RGD1561291
Definition
(RefSeq) AT hook containing transcription factor 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: ELYS-bb ELYS
Motif
Other DBs
NCBI-GeneID: 360886
NCBI-ProteinID: NP_001258199
RGD: 1561291
Ensembl: ENSRNOG00000023541
UniProt: D3ZZZ0
Position
13q26
AA seq 2240 aa AA seqDB search
MQDLTAQVTSDLLQFPEVTIEALGEDEITLESVLRGKFAAGKNGLACLACGPQLEVVNSL
TGERLSAYRFSGVNEQPPVVLAVKEFSWHKRTGLLIGLEEADGSVLCLYDLGISRVVKAV
VLPGRVTAIEPIINHGGASASTQHLHPSLRWLFGVAAVVTDVGQILLIDLCLDDLSCSQN
EVEASDLEVITGIPAEVPHIRESVMREGRHLCFQLVSPSGVAISTLSYINRTNQLAVGFA
DGYLALWNMKSMKREYYTQLEGGRVPVYAVVFQEPENDPRNCCYLWAVQSTQESEGDVVS
LHLLQLAFGDRKCLASGQILYEGLEYCEERYTLDLSGGMFPLRGQTSNTKLLGCQSIERF
PSHGDREESMREALSPDTSVSVFTWQVNIYGQGEPSVYLGLFDINRWYHAQMPDSLRSGE
SLHNCSYFALWSLESVVSRTSPHHILDILVHERSLSRGVPPSYPPPEQFFNPSTFNFDAT
CLLNSGVIHVTCTGFQKETLTFLKKSGPTLNEVIPDSYNRCLVAGLLSPRLIDIQPSSLS
QEEQLEAILSAAIQTSSLGLLTGYIRTWIIEEQPNSAANLRFVLEWTWNKVILTKEDFDR
LCVPLFDGSCRFIDPQTIQSIQQCHLLLSNLSTVLSCFAMEAQGITERGLVDLNNKHMVT
QLICQYAQMVLWFCHSGLLPEGLDDTLQLSRLRYNYPVIQNYYTSRRQKCERSPRGKWSR
DCLLIDGLVSQLGDEVEKLWKRDEGGTGKYPPASIHALLDIYLLDNISEASKHAITIYLL
LDIMYSFPNKTDTPIESFPTAFAISWGQVKLVQGFWLLDHNDYENGLDLLFHPVTAKPAS
WQHSKIIEAFMSQGEHKQALRYLQTMKPTVSSSSDVLLHLSVLLFNRCMVEAWNLLRQNS
NTVNIEELLKHAYEVCQEMGLMEDLLKLPFTNTEQECLVNFLQSSSSVQNHEFLLVHHLQ
RANYISALKLNQTLKNNLTSDRDPRLRERSVTRNSILDQYGKILPRVQRKLAVERAKPYH
LSTSSVFQEVSRPKPLSAFPKKALTGTVITRSTFISNVLSKIGEVWASHEPRNGISLFNS
PKTEQPSPVVHSFPHPELPEAFVGTPISNPSQRISRLLDLVVHPIPQPSQRLEFIQQSPT
RSPLCLLSSSLPLSSQLKRPHQQASRPSELLLLETPLIVKKAKSLALSATSSGFAEFTPP
SILRSGLRTTSLASPSQSPGRSLTPPFRLKETRISFMEEGMNTHWTDTATDDRNAKAFVS
TSFHKCGLPAETEWMKTNDKNTYFPLDVPAKVPQKVVAESLDTHSPRSLEKLDVSKDSTV
SSRSDQTLEYHDAPSPEDLEGGVFVSPKPASSSTELTTNSMVQTEKDNDKNLFKSEGTPS
AMEKQIGTIEASVEAFSEFSHLDPVERAEASLGVSSVREGETSTSKSKTSVLDGIVSIES
RTSIPIADHNEFVANKVEDVESSESTTSKCPVTSERSLDKELTLNLKGDEMEAVVPKESV
GLPEERPQTSAGPSDTQEIHLIGCEKLEVQNSEEVAKSLSFPELCPLGAHRPQYNFDVIE
QQFRDLPDDKDSAECDVAEVDGELFVAQSNFSLILEGEEGEVEASDSNVLPKVTNIATKE
KPVSCEEPDNEGHVTDLPSAVTGDQESHKVETLPYVPEPVKVAIAENLLDVIKDTRSKEA
THVAAVEDVDEDRAVMIPKAAHPSRLTNSTPKTVKERRAETVSASQGDDSIAPRTLTRRQ
RALSLNVTSEQEPSAAATPQKKTRKVKETREFSESTCSDVKVAPENQLTAPSPSPSRRGR
KKKDLGQGPLATSGAVEEPQATPERLRLRVQPPEPAAEETPSRAKAKLSSARKGTPRRLR
KSIEDGPSADIVNEVRGRKAAGHGRTVRELRSASVEDTQKMEYEQDEERGDQQLPLKRKR
VREREDSVSGVTEEPKLDSSQLTLQVGLDVPATPRKRGRRPKRVVPLGADGTTPGKEQTS
PQKEGPVVRRSTRNTPARNVSTLEKPILVPNKEAATVMTSKKKPTKKSADGSPKGPFPAV
SDLADEAAHRESTDQGVLTSAAFTTPSWSTRTRSRRTMLLTDISEPQTEPLLSSPSLKVP
KKETKAKNMEAAAQLKELVSDISSRFVVSPPALRTRQKSTSNASKLLGELESNPKPVEII
EQKPKRSRTVKTKVSRNTGKGSSWSPPPIEIKLISPLASPVDEIKVSKPRKTAEVAGKTL
GRGRKKPSSFPKQILRRKML
NT seq 6723 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacttgacagctcaagtgactagtgatctcctgcagttcccagaagtgactatt
gaagctcttggagaagatgaaataacgttagaatctgtgcttcgtgggaaatttgctgcc
gggaaaaatggattggcttgcttagcttgtggtccacaacttgaagtcgtaaactcccta
acaggagagcggctgtctgcatatagattcagtggagtaaatgaacagcctcctgtagtt
cttgcagtgaaagaattctcttggcataagagaactggattgctaataggattagaagaa
gcagatgggagtgttctttgcctttatgaccttggtatatccagagtggtcaaagcagtt
gttcttcctggaagggtaacagctatcgagcctataattaaccatggaggagccagtgca
agtacccagcacttacacccaagccttcgatggctttttggtgtggcagctgtggtaact
gatgttggacagatccttcttattgatctctgtttggatgacttgtcatgcagtcaaaat
gaagtagaggcatcagatcttgaagttatcactggtattccagctgaagtaccacacatc
agagagagtgtgatgagagaggggcgccacctgtgtttccagttagttagcccatcggga
gtagccatttctaccctcagttacattaacaggacaaatcagcttgctgtcggttttgct
gacggctacttggcactttggaacatgaaaagcatgaaaagagaatactatacacaattg
gaaggtggaagggttcctgtctatgcagttgtttttcaagagcctgagaatgatcctcgt
aactgctgttatttatgggctgtgcaatccacacaagagagtgaaggggatgttgtgagt
ttgcatctgcttcagctggcttttggtgatagaaaatgtttggcatcagggcagatctta
tatgagggattagaatactgcgaagaaagatatacactggatctatcaggtggcatgttc
cccttaaggggacagactagcaataccaaattgttgggctgccagagtatagagcgattt
ccgtctcatggtgacagagaagaaagcatgagagaagctctgtcccctgacactagcgtt
tctgtctttacctggcaagtgaacatatatggacagggagagccttctgtgtatttaggg
ctttttgacataaatcggtggtatcatgcacaaatgcctgattctttaaggtctggggaa
tctctgcataattgctcttacttcgcattgtggtcattggagtcggttgtgagtaggact
tctccacatcacatcctggacatactcgtacacgagagaagtttaagtcgaggggttcct
ccctcctatccacctccagaacagttttttaacccaagtacttttaactttgatgcgact
tgcttgttaaactctggagttatccatgtaacttgtactggatttcagaaggagactttg
acatttttaaagaaatcaggaccaactcttaatgaagtcattcccgatagttacaatcga
tgtcttgttgccggtctcctctcaccaaggcttattgatattcagccttccagtttaagt
caagaagaacaattagaagctatattgtcagcagcaattcagacaagttccttgggactt
ttgactggttacatcagaacatggataatagaagaacaaccaaattctgctgctaatcta
cggtttgttcttgagtggacatggaataaggtgatcctcacaaaagaagactttgacagg
ctttgtgtgccgttgtttgacggttcctgtcgcttcatcgacccacagaccattcagtcc
atccagcagtgtcatttactgcttagcaacctcagtacagtcttaagctgtttcgcaatg
gaggcccagggtatcactgaaagaggacttgtggacttgaacaataagcatatggttacc
cagcttatctgtcagtatgcacaaatggttctgtggttctgtcactctgggcttttacct
gaaggcttagatgatactctgcagctgtcaagactacgctacaactaccctgtaattcag
aactactataccagtcgtcggcagaagtgtgaacgttcacccagagggaagtggagccga
gactgcttgctgatcgatggactggtctctcaactaggagatgaagttgagaagctgtgg
aagcgggatgaaggtggcacaggaaaataccctcctgctagcatccatgcattacttgat
atatatttattagacaacattagtgaagcaagcaaacatgctattaccatttatttgctg
cttgatattatgtattcctttcccaataaaacggatacccccattgaatctttcccaact
gcttttgctatttcttggggccaagttaaactagttcaaggattttggctgctagatcat
aatgattatgagaatggtttagaccttctgtttcacccagttactgcaaaacctgcatcg
tggcagcattcaaagataattgaagcctttatgagtcagggagagcacaaacaggctctc
cgctatcttcagacaatgaagccaacagtgtccagtagcagtgatgttctccttcacctc
tctgttctgctttttaatagatgcatggttgaggcgtggaacttactgcgacagaactca
aacacagtaaatatagaggaattgctgaagcatgcttatgaagtttgtcaggagatgggc
ttaatggaggatttactgaagctaccgtttacaaacactgagcaggaatgtttagtgaat
tttttacaatccagttccagtgttcagaatcatgaattccttctagttcaccatttacag
cgtgccaattatatttctgccttgaaactgaaccagactctgaagaataatctcacgagt
gatcgtgaccctcgattgcgggagagatcagtgactcgaaattctatattagaccagtat
gggaaaatcctacctagagtccaaagaaagttagctgttgagcgagccaagccttaccat
ctgtcaacatcgtcagtttttcaggaagtttctagacccaaaccattatcagcatttcca
aagaaagctctaactggaacagtgataacgcggtctacattcatcagcaacgtgctatct
aaaattggagaggtgtgggcaagccatgagcccagaaacggcatctcacttttcaacagt
cctaaaacagagcaaccatctcctgtagtgcactctttcccacatccagagcttcctgag
gcatttgttggaacaccaatttcaaatccatcccagagaatttctagattactggatttg
gttgttcatcctatcccccaaccctcccaacgtttggagtttattcagcaaagtcccaca
agatctcctttgtgtctgctgtccagttcattaccattaagttcacagttaaaaaggcca
catcagcaagcctccaggccttcagaattacttttacttgaaactcctcttatagttaag
aaagctaagtctttggctctctcagctacatcttctggatttgccgagtttactcctcca
tccatccttaggtctggtcttcgaacaacatctttagcttctccctctcagtcacctgga
agatctctcactccgcctttcagacttaaagaaactaggatttcattcatggaagaaggc
atgaacacacactggactgatacagccacagatgaccgaaatgcaaaagcgtttgttagt
acatctttccataaatgtggacttccagcagaaactgaatggatgaagaccaatgataaa
aatacatattttcctttggatgtccctgcaaaggttcctcagaaagtggttgcagaatcg
ctggatacccattctcctcgaagtctagagaaactggatgtgagcaaagacagcactgtt
tccagcaggtcagaccagaccttagagtatcatgatgcaccatcaccagaggacttggaa
gggggtgtttttgtgtcccccaagccagcgagctcttccactgaactaactactaattca
atggtacaaaccgagaaggataatgataaaaatttgtttaagtcagaaggtactccttca
gccatggagaaacagataggcaccatagaagcttcggtggaagcattttcagaattcagt
cacttagaccctgttgaaagagctgaagcttctcttggtgtgtcatctgtccgtgaaggg
gaaacctccacttcaaaatccaagacatcggttctggatggaatagtgtctattgagagc
cgaacttccatacctatagcagaccacaatgaatttgtggccaacaaggtagaagatgtt
gaaagctctgagtctaccacctccaagtgccctgttacctctgaacgtagccttgacaaa
gaactaacattaaatttaaaaggagatgaaatggaagctgttgtaccaaaagagagcgtt
ggcttaccagaagaaagacctcagacttctgctggtccttctgatactcaagaaattcat
ctaattggatgtgaaaaacttgaagttcaaaattcagaagaggtggccaagagtctttcg
tttcccgagttgtgtcccttaggagcacacagacctcagtataatttcgatgtcattgag
cagcagtttcgtgacttgcccgatgataaagactctgctgaatgtgatgtcgctgaagtg
gatggggagctctttgtggcccagagcaactttagcttgattttagaaggcgaagaagga
gaggttgaggcaagtgactctaatgtgttaccgaaagtgaccaacatagcaaccaaggaa
aaacctgtgtcctgcgaggaacctgataatgaaggacatgttacagatttgccatctgct
gtgactggtgaccaagagtctcacaaggtagagactttaccatatgtgcctgaaccagtt
aaagtggcaattgcagaaaatttgttggatgtaattaaagacacacgaagtaaagaagca
actcacgtggcagccgttgaggatgtcgatgaggacagagcagtaatgatccccaaggct
gcacatccgtccaggctgacgaactccacaccgaagactgttaaggaaagacgcgccgag
accgtaagtgccagccagggtgacgacagcatagctcctagaactctcacaagaaggcag
cgtgccctaagcctgaatgtcacttcagaacaagagccctcagcagctgctactcctcag
aagaaaactagaaaagtaaaagaaactcgtgagttttctgaaagtacctgttctgacgta
aaagtagcacctgagaaccagctgacagctcccagtccttccccttccaggagaggaagg
aagaaaaaggaccttggccaaggtccactggcaacctctggtgctgtggaggagccccag
gcgacaccagaaagactgaggctgagagtgcagccacctgagccagcagctgaggaaaca
ccttctagagcaaaagccaagctttcatctgctaggaaggggactcctagaagacttagg
aaatctatagaagatgggccaagtgcagacattgtaaatgaggtcagaggcaggaaagca
gccggtcatggcaggactgtcagagagctgaggagtgccagtgtagaggatactcaaaag
atggagtatgaacaagatgaggaacgcggtgaccagcaactgcctctaaaacgaaaaagg
gtcagagagagagaagatagtgtgtccggtgtgacagaagagcctaagcttgactcatcc
cagttaactcttcaggtgggacttgatgtacctgccacccctaggaaacgtggtagaagg
cccaagagggtagttcccttaggagctgatggtaccacaccaggtaaggaacagacaagc
ccccagaaggaaggtccagttgtccggaggtctacacggaacaccccagctagaaatgtg
agtactttagaaaaacccattttagtgccaaataaggaagctgctacagtgatgacgtct
aagaaaaaacctacgaagaagtctgcagatggaagcccaaaaggtccatttccagcagta
tcagacttggcggatgaagcagcccaccgagagtccactgaccaaggagtgctcaccagt
gctgcgttcactacgccctcctggagcacaaggactaggtctagaaggaccatgttgtta
acggacatttctgagccccaaactgagcctttgctttcctccccttcattgaaggtgcca
aagaaagagacaaaagctaaaaacatggaggccgctgcccagctgaaagaattggtgtca
gatatatcttctcggtttgtggtttcccctcctgccttgagaaccaggcagaaaagtaca
tccaatgcttccaagcttctaggtgaattggagagtaaccctaaaccagtagaaatcata
gaacaaaaaccaaaaagaagcaggactgtgaagacaaaagtgagcagaaacacaggaaaa
ggaagttcttggtcacctccccctatagaaattaaactgatctctcccttggcaagtccg
gtggatgaaataaaggtcagcaagccaagaaagactgcagaagtagcaggaaaaactctt
ggaaggggcagaaagaagccatcttcttttccaaagcaaattttacgcaggaaaatgctg
taa

DBGET integrated database retrieval system