KEGG   Rattus norvegicus (rat): 360887Help
Entry
360887            CDS       T01003                                 

Gene name
Coq8a, Adck3, Cabc1
Definition
(RefSeq) coenzyme Q8A
  KO
K08869  aarF domain-containing kinase
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    360887 (Coq8a)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  ABC1 family
   360887 (Coq8a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC1
Motif
Other DBs
NCBI-GeneID: 360887
NCBI-ProteinID: NP_001013203
RGD: 1308245
Ensembl: ENSRNOG00000043201
UniProt: Q5BJQ0
Position
13q26
AA seq 649 aa AA seqDB search
MAAMLGDAIMVAKGLAKLTQAAVETHLQNLGLGGELILAARALQSTAVEQISMVFGKVQG
QDKHEDSYATENFEDLEAEVQFSTPQAAGSSPDFSTASSLDQPLSSSLGHAHREGPAPAY
VSSGPFREAGLSGQATSPLGRVNGRLFVDCRDLFLANSIQRRFFHQDQAPVGGLTAEDIE
KARQAKARPESKPHKQMLSERARERKVPVTRIGRLANFGGLAVGLGFGALAEVAKKSLRS
ENSTGKKAVLDSSPFLSEANAERIVSTLCKVRGAALKLGQMLSIQDDAFINPHLAKIFER
VRQSADFMPLKQMTKTLNNDLGPHWRDKLEYFEERPFAAASIGQVHLARLKGGREVAMKI
QYPGVAQSINSDVNNLMAVLNMSNMLPEGLFPEHLIDVLRRELTLECDYQREAAYAKKFR
ELLKDHPFFYVPEIVDELCSPHVLTTELITGFPLDQAEGLSQEVRNEICYNILVLCLREL
FEFHVMQTDPNWSNFFYDPQQHKVALLDFGATREYDRSFTDLYIQVIRAAADQDREAVLK
KSIEMKFLTGYEVKAMEDAHLDAILILGEAFASEEPFDFGTQSTTEKIHNLIPIMLKHRL
IPPPEETYSLHRKMGGSFLICSKLKACFPCKAMFEEAYSNYCRMKSGLQ
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggctgctatgttgggggatgccatcatggtggccaaaggccttgccaagctgacccag
gcagctgtggaaactcacctgcagaacctgggccttggtggggagctcatcctggcagcc
agggccctgcagtctacagctgtggagcagatcagcatggtctttggaaaggtgcagggt
caggataagcatgaagattcatatgccactgagaacttcgaagatctggaagccgaagtt
cagttctcaacaccacaggcagctggaagctccccagatttctccacagcctcctccctg
gaccagccactgtcttcatccctgggtcatgcccacagggagggcccagctcctgcctat
gtttccagtggacctttcagggaagcagggctctctggccaggctacctctcctctgggc
agagtcaatggaaggctctttgtagattgtagagacttgttcttggccaacagcatccag
cgaagattcttccaccaggaccaggcccctgtgggaggcctcaccgctgaagacattgaa
aaggcccgtcaggccaaggctcgcccagagagcaagccacacaagcagatgctcagtgag
cgggctcgggagcggaaggtgccagttacccggattgggcggttggccaactttggaggg
ctggctgtaggtctgggctttggggctttggctgaggttgccaagaagagtctgcgttct
gagaactccacagggaagaaagctgtgctggattctagccccttcctgtcagaggcgaat
gcagagcgcattgtgagtacattgtgcaaggtgcgtggggccgcactgaagctgggccag
atgctgagcatccaggatgatgccttcatcaaccctcacctggccaagatctttgagcgg
gtgaggcagagcgctgacttcatgccactgaaacagatgacgaaaactctcaacaatgac
ctgggcccccattggagggacaagctggagtactttgaagagcggccctttgcggctgcc
tccatagggcaggtgcacctggcccgtttgaagggtggccgtgaggtggccatgaagatt
cagtaccctggtgtggcccagagcattaacagtgacgtcaacaacctcatggctgtgctg
aacatgagtaacatgcttccagaaggcctgttcccagagcacctgattgatgtgctgagg
cgggagcttacccttgagtgtgactaccagcgggaggctgcctatgccaagaagttcagg
gagctgctgaaggaccaccccttcttctatgtgcctgagattgtggacgagctgtgcagc
ccccatgtgctgaccacagagctgataacaggcttccccctggaccaggcagaagggctg
agccaggaagtgcggaatgagatctgctacaacattttggtgctgtgcctgagggagctg
tttgagttccatgtcatgcagactgaccccaactggtccaatttcttttatgaccctcag
cagcacaaggtggctctcctggactttggggcaactcgagaatatgaccgatcctttact
gacctctacattcaggtcatccgggctgctgctgaccaggacagggaggcagtgctgaag
aagtccatagagatgaagttcctcactggttatgaggtcaaggccatggaggatgcccac
ctggatgccattctcatcctgggggaggcctttgcttcggaagagccctttgacttcggc
acgcagagcaccactgagaagatccataacctgatccccatcatgctgaagcaccgcctc
atcccgcctcctgaggagacctactctctgcaccgcaagatggggggctctttcctcatc
tgttccaagctgaaggcctgcttcccctgcaaggccatgtttgaggaagcgtacagtaac
tactgcaggatgaagtctgggctgcagtag

DBGET integrated database retrieval system