KEGG   Rattus norvegicus (rat): 360891
Entry
360891            CDS       T01003                                 

Gene name
Enah
Definition
(RefSeq) protein enabled homolog
  KO
K05746  enabled
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04360  Axon guidance
rno04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    360891 (Enah)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    360891 (Enah)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    360891 (Enah)
SSDB
Motif
Pfam: WH1 VASP_tetra Ran_BP1
Other DBs
NCBI-GeneID: 360891
NCBI-ProteinID: NP_001012150
RGD: 1307666
Ensembl: ENSRNOG00000031934
UniProt: Q5XHX3
Position
13
AA seq 526 aa
MDVEFVSYSIPKLRSSQSLRISEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHH
TGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVF
ASAMMHALEVLNSQEAGPTLPRQNSQLPAQVQNGPSQEEMEIQRRQLQEQQRQKELERER
MERERLERERLERERLERERLEQEQLERQRQEREHVERLERERLERLERERQDRERERER
LEQLEREQVEWERERRMSNAGHVLGPPAPPPPPPLPSGPAYASALPPPPGPPPPPPLPSA
GPPPPPPPPPPLPNQVPPPPPPPPAPPLPASGIFSGSMSEDNRPLTGLAAAIAGAKLRKV
SRVEDGSFPSGGNTVSVNLASSKTDSGRGNGPLPLGGSGLMEEMSALLARRRRIAEKGST
IETEQKEDRSEDAEPVTSKAASTSTPEPTRKPWERTNTMNGSKSPVISRPKSTPSSQPSA
NGVQTEGLDYDRLKQDILDEMRKELAKLKEELIDAIRQELSKSNTA
NT seq 1581 nt   +upstreamnt  +downstreamnt
atggatgtagaatttgtatcttactcgataccaaagctcagaagtagccagagcctcaga
atcagtgaacagagtatctgtcaggcaagagctgctgtgatggtttatgatgatgccaat
aagaaatgggtgccagctggtggctcaaccgggttcagcagagtacatatatatcaccat
acaggcaacaacacattcagagtggtgggcagaaagattcaagaccatcaggttgtgata
aactgtgccattcctaaaggactgaagtacaatcaagctacacagactttccaccaatgg
cgggatgctagacaggtgtatggtctcaactttggcagcaaagaggatgccaatgtcttc
gcaagtgccatgatgcatgccttagaagtgttaaattcacaggaagcagggccaacattg
cctagacagaattcacagctacctgctcaagttcaaaatggcccatcccaagaagagatg
gaaatccagagaaggcaactgcaagagcagcagcgacagaaggagctggagagggagcga
atggagagggaaaggttggagagagaacgactagaacgagagaggctagagagggagcgc
ctggaacaggagcagctggagcggcagaggcaggagagggagcacgtggagcgcctggaa
agggagcgcctggagcggctggagagagagaggcaagaccgagagcgagagcgcgagcgc
ctggaacagctggagcgagagcaagtggagtgggagagagagcgcagaatgtccaatgct
ggccatgtcttgggaccacctgcacctccaccaccaccccccctaccatcaggccctgcc
tatgcttcagcacttccccctcctcctggaccccctccaccacctccactgccatccgct
ggacctcctcctccaccgcctccaccaccccctcttcctaatcaagttcctccccctcct
ccaccacctcctgcccctcccctccccgcatctggaattttctctggatccatgtcagaa
gacaatcgccctttaactggacttgcagctgcaatcgcgggagcaaaacttaggaaagtg
tctcgggtggaggatggctctttcccaagtggaggaaatactgtgagtgtgaacttggcc
tcatccaaaacagattctggtcgtggcaatggaccccttcctctagggggcagtggctta
atggaagaaatgagtgccctgctggccaggaggagaagaattgctgagaagggatcaaca
atagaaacagaacaaaaagaagacagaagtgaagatgcagagcctgtaacttctaaggca
gcatcaacaagtacacctgaaccaaccagaaaaccttgggaaagaacaaacacaatgaac
ggcagtaagtcacctgtcatctccagacccaaatccacaccttcctcacagccaagtgcc
aatggggtccagacagaagggcttgactatgacaggctgaagcaggacattttagatgaa
atgagaaaagaacttgcaaagctgaaggaggagctcattgatgcaatcaggcaggaactg
agcaagtcgaatactgcataa

KEGG   Rattus norvegicus (rat): 361517
Entry
361517            CDS       T01003                                 

Gene name
Vasp
Definition
(RefSeq) vasodilator-stimulated phosphoprotein
  KO
K06274  vasodilator-stimulated phosphoprotein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04510  Focal adhesion
rno04530  Tight junction
rno04611  Platelet activation
rno04666  Fc gamma R-mediated phagocytosis
rno04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    361517 (Vasp)
   04022 cGMP-PKG signaling pathway
    361517 (Vasp)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    361517 (Vasp)
   04530 Tight junction
    361517 (Vasp)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    361517 (Vasp)
   04666 Fc gamma R-mediated phagocytosis
    361517 (Vasp)
   04670 Leukocyte transendothelial migration
    361517 (Vasp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    361517 (Vasp)
   04147 Exosome [BR:rno04147]
    361517 (Vasp)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     361517 (Vasp)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   361517 (Vasp)
SSDB
Motif
Pfam: WH1 VASP_tetra ASD2 Ran_BP1
Other DBs
NCBI-GeneID: 361517
NCBI-ProteinID: NP_001101945
RGD: 1311542
Ensembl: ENSRNOG00000016367
UniProt: B5DEX4
Position
1
AA seq 376 aa
MSNETVICSSRATVMLYDDSNKRWLPAGTGPQAFSRVQIYHNPTANSFRVVGRKLQPDQQ
VVINCAIIRGVKYNQATPIFHQWRDARQVWGLNFGSKEDAAQFAIGMANALEALEGGGPP
PAPAPPAWSTQNGPSPEELEQQKRQPEHLERRVSNAGGPPAPPAGGPPPPPGPPPPPGPP
PPPGLPPSGVSGAGHGTGVAPPPAPPLPTAQGPSSGGSGAPGLAAAIAGAKLRKVSKEEA
SGGPLAPKAENSRGTGGGLMEEMNAMLARRRKATQVGEKPPKDESASQEESEARIPAQSE
PVRRPWEKNSTTLPRMKSSSSVTTSEAHPSVPSSSDDSDLERVKQELVEEVRKELQKMKE
EIIEVFVQELRKRGSP
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgagcaacgagacggtcatttgttccagccgggctactgtgatgctttacgatgacagc
aacaaacgatggcttcctgctggcaccggtccccaggcctttagccgcgtccagatctac
cacaaccccactgctaactctttccgagttgttggccgcaagctgcagcctgaccagcag
gtggttatcaactgtgccatcattcgaggtgtcaagtacaatcaggccactcccatattc
caccagtggcgtgatgcccgccaggtctggggcctcaacttcggcagcaaggaggacgct
gcgcagtttgcgatcggcatggccaatgccctggaggccttggaaggaggtgggcctccc
cctgccccagcaccccctgcctggtctacccagaatggcccctccccagaggagctggaa
caacagaaaaggcagcctgaacatttggagcgccgggtctccaatgcaggaggcccacct
gctcccccagctgggggcccacctccacctccaggacctccccctcctccgggtcccccc
ccacccccaggtctgcccccctcaggggtatctggggcaggtcatggaacaggtgtagcc
ccaccccctgcacccccactccctacagcacagggccccagtagtgggggttccggggcc
ccaggcctggccgctgccattgctggagccaaactcaggaaagtgagcaaggaggaggcc
tctggggggcccctggcccccaaagctgagaatagtcgaggcactggtggggggcttatg
gaagagatgaacgccatgctggcccggagaaggaaagccacacaggttggggagaagccc
cccaaagacgagtcagccagtcaggaggagtcagaggcccgaatccctgcccaaagtgaa
cctgtgcgaagaccctgggagaagaacagcacaaccttgccaaggatgaagtcatcctct
tctgtgactacctccgaggcccacccctctgtgcccagctccagtgatgactccgacttg
gagagggtgaagcaggagcttgtggaagaggtgcggaaggagctacagaaaatgaaagag
gaaataatcgaagtctttgtccaggagctgaggaagcggggttctccttga

KEGG   Rattus norvegicus (rat): 79115
Entry
79115             CDS       T01003                                 

Gene name
Evl
Definition
(RefSeq) ena/VASP-like protein
  KO
K23487  Ena/VASP-like protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    79115 (Evl)
SSDB
Motif
Pfam: WH1 VASP_tetra Ran_BP1 Cas9_PI2 Kelch_1
Other DBs
NCBI-GeneID: 79115
NCBI-ProteinID: NP_077061
RGD: 621150
Ensembl: ENSRNOG00000014476
UniProt: O08719
Position
6
AA seq 393 aa
MSEQSICQARASVMVYDDTSKKWVPIKPGQQGFSRINIYHNTASNTFRVVGVKLQDQQVV
INYSIVKGLKYNQATPTFHQWRDARQVYGLNFASKEEATTFSNAMLFALNIMNSQEGGPS
TQRQVQNGPSPEEMDIQRRQVMEQQHRQESLERRISATGPILPPGHPSSAASATFSCSGP
PPPPPPPVPPPPTGSTPPPPPPLPAGGAQGTNHDESSASGLAAALAGAKLRRVQRPEDAS
GGSSPSGTSKSDANRASSGGGGGGLMEEMNKLLAKRRKAASQTDKPADRKEDENQTEDPS
TSPSPGSRATSQPPNSSEAGRKPWERSNSVEKPVSSLLSRVKPAGSVNDVGLDALDLDRM
KQEILEEVVRELHKVKEEIIDAIRQELSGISTT
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgagcgaacagagtatctgccaagcacgggcctccgtgatggtctacgatgacaccagt
aagaaatgggtaccaatcaagcctggccagcagggattcagccggatcaacatctaccac
aacactgccagcaacactttcagggttgtaggggtcaagctacaggatcagcaggttgtg
atcaattattcaattgtgaaagggctgaagtacaatcaggcaacacccaccttccatcag
tggcgagacgcccgtcaggtctatggcttaaactttgcgagtaaggaagaagcaaccaca
ttctccaacgcgatgctctttgccctgaacatcatgaactcccaagaaggaggcccctcc
acacagcgtcaggtgcagaatggcccctctcctgaggagatggacatccagagaagacaa
gtaatggagcagcagcaccgccaggagtctctggagagaagaatctccgccacagggccc
attctcccccctgggcatccgtcatcggcagccagcgccaccttctcctgtagtggacct
ccacctccacctccacctccagttccacctccacccacagggtctactcccccgcccccg
cccccgctgcctgctggaggagcccaggggaccaaccacgatgagagctctgcatcagga
ctggctgctgctctggcaggagccaagctaaggagggtgcagcggccagaggatgcatct
ggaggctccagtcctagcgggacttcaaagtccgatgccaaccgggcaagcagtggggga
ggaggaggaggcctcatggaagaaatgaacaagctgctggctaagaggagaaaggcagcc
tcccagacagacaagcccgctgacagaaaggaagatgagaaccaaacggaagatcctagc
acctccccatccccagggagccgagccaccagccagccacctaattcctcagaggctggc
cgaaagccctgggaacggagcaactcggtggagaaacctgtgtcctcgttgctgtccagg
gtgaagcctgctgggagtgtgaatgacgtgggcctggatgccttagatttggaccggatg
aaacaggagattctggaggaggtggtccgagagctccacaaggtgaaggaggagatcata
gatgccatcaggcaggaactaagtgggatcagcaccacataa

DBGET integrated database retrieval system