KEGG   Rattus norvegicus (rat): 360903Help
Entry
360903            CDS       T01003                                 

Gene name
Fgfrl1, Fgfr5
Definition
(RefSeq) fibroblast growth factor receptor-like 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 ig Ig_2 V-set Ig_6 Ig_5 Ig_4 Receptor_2B4 C2-set_2 Izumo-Ig C1-set DUF2914
Motif
Other DBs
NCBI-GeneID: 360903
NCBI-ProteinID: NP_954545
RGD: 735156
Ensembl: ENSRNOG00000024207
UniProt: Q7TQM3
Position
14p22
AA seq 529 aa AA seqDB search
MTRSPALLLLLLGALPSAEAARGPPRMADKVVPRQVARLGRTVRLQCPVEGDPPPLTMWT
KDGRTIHSGWSRFRVLPQGLKVKEVEAEDAGVYVCKATNGFGSLSVNYTLIIMDDISPGK
ENPGPGGSSGGQEDPVSQQWARPRFTQPSKMRRRVIARPVGSSVRLKCVASGHPRPDIMW
MKDDQTLTRLEASEHRKKKWTLSLKNLKPEDSGKYTCRVSNRAGAINATYKVDVIQRTRS
KPVLTGTHPVNTTVDFGGTTSFQCKVRSDVKPVIQWLKRVEYGSEGRHNSTIDVGGQKFV
VLPTGDVWSRPDGSYLNKLLISRARQDDAGMYICLGANTMGYSFRSAFLTVLPDPKPPGP
PVAHSSSTTSLPWPVVIGIPAGAVFILGTVLLWLCQTKKKPCAPASTLPVPGHRPPGTSR
ERSGDKDLPSLAVGICEEHGSTMAPQHILAPGSTAGPKLYPKLYTDVHTHTHTHTCTHTL
SCGGQGSSAPACPLSVLNTANLQALCPEVGVWGPRQQVGRIENNGGRVS
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgacgcggagccccgcgctgctgctgctgctattgggggccctcccgtcggctgaggcg
gcgcgaggacccccaagaatggcagacaaagtggtcccacggcaggtggcccgcctgggc
cgcactgtgcggctacagtgcccagtggagggggacccaccaccgttgaccatgtggacc
aaagatggccgcacgatccacagtggctggagccgcttccgtgtgctgccccaggggctg
aaggtgaaggaggtggaggccgaggatgccggtgtttatgtgtgcaaggccaccaatggc
ttcggcagcctcagcgtcaactatactctcatcatcatggatgacattagtccagggaag
gagaaccctggaccaggtggctcttctgggggccaggaagacccagtcagccagcagtgg
gcacggcctcgcttcacacagccctccaagatgaggcgccgagtgattgcacggcccgtg
ggtagctctgtgcggctcaagtgtgtggccagtgggcacccacggcctgacatcatgtgg
atgaaggatgaccagaccttgacacgtctagaggccagtgaacacagaaagaagaagtgg
acgctgagcttgaagaacctgaagcctgaagacagtggcaagtacacgtgccgtgtatcc
aaccgggcaggtgccatcaacgccacctacaaagtggatgtaatccagcgtactcgttcc
aagcctgtgctcacggggacacaccctgtgaacacaacggtggacttcggtgggacaacg
tccttccagtgcaaggtgcgcagcgacgtgaagcctgtgatccaatggctaaagcgggtg
gagtacggctctgagggtcgccacaactccaccattgatgtgggtggccagaagtttgtg
gtgttgcccacgggtgatgtgtggtcacggcctgacggctcctacctcaacaagctgctc
atctctcgggcccgccaggatgatgctggcatgtacatctgcctgggtgcaaacaccatg
ggctacagtttccgtagcgccttcctcactgtattaccagaccccaaacctccagggcct
cctgtggctcattcatcctcaaccaccagcctgccgtggcctgtggtgatcggcatccca
gcaggtgctgtcttcatcctaggcacggtgttgctctggctttgccagactaagaagaag
ccatgtgcccctgcatccacacttcctgtgcctgggcatcgtcccccagggacatcccga
gaacgcagtggtgacaaggacctgccctcattggctgtgggcatatgtgaggagcatgga
tccaccatggccccccagcacatcctggccccaggctcaactgccggccccaagctgtac
cctaagctgtacacagatgtgcacacgcacacgcatacgcacacatgcacacacacgctc
tcatgtggagggcaaggctcatcagcaccagcatgtccactatcagtgctaaatacagcc
aatctccaagcactgtgtcccgaggtgggcgtatgggggccaaggcagcaggttgggagg
attgagaacaatggaggaagagtatcttag

DBGET integrated database retrieval system