KEGG   Rattus norvegicus (rat): 360905Help
Entry
360905            CDS       T01003                                 

Gene name
Mtf2, RGD1304727
Definition
(RefSeq) metal response element binding transcription factor 2
  KO
K11485  metal regulatory transcription factor 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    360905 (Mtf2)
   03036 Chromosome and associated proteins [BR:rno03036]
    360905 (Mtf2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys4HisCys3 PHD fingers
    360905 (Mtf2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    Other polycomb group proteins
     360905 (Mtf2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mtf2_C PHD Tudor_2 Prok-RING_1 DUF4537 DUF1325 C1_1 Chromo DUF3573
Motif
Other DBs
NCBI-GeneID: 360905
NCBI-ProteinID: NP_001094368
RGD: 1304727
Ensembl: ENSRNOG00000000075
UniProt: F1LMD5 B1H2A5 Q566Q3
Position
14p22
AA seq 593 aa AA seqDB search
MRDSTGAGNSLVHKRSPSRRNQKTSASLNKLSLQDGHKAKKPACKFEEGQDVLARWSDGL
FYLGTIKKINILKQSCFITFEDSSKSWVLWKDIQTGATGSGEMVCTICQEEYSEAPNEMV
ICDKCGQGYHQLCHTPHIDSSVIDSDEKWLCRQCVFATTTKRGGALKKGPNAKALQVMKQ
TLPYSVADLEWDAGHKTNVQQCYCYCGGPGDWYLKMLQCCKCKQWFHEACVQCLQKPMLF
GDRFYTFICSVCSSGPEYLKRLPLQWVDIAHLCLYNLSVIHKKKYFDSELELMTYINDNW
DRLHPGELADTPKSERYEHVLEALNDYKTMFMSGKEIKKKKHLFGLRIRVPPVPPNVAFK
AEKEPEGTSHEFKIKGRKASKPTSDSREVSNGIEKKGKKKSVGRPPGPYTRKMIQKTAEP
PLGKESVSENPALDLPCSIGRTEGVAHSSNTSDVDLTGASSAKETTSSSIPRHYGLSDSR
KRTRTGRSWPASIPHLRRRRGRLPRRALHTQNSEVVKDDEGKEDYQFEELNTEILNNLAD
QELQLNHLKNSITSYFGAAGRIACGEKYRVLARRVTLDGKVQYLVEWEGATAS
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgagagactctacaggagcaggtaattcactggtccacaagcggtctccttcacgtcga
aaccaaaagacctcagcatccttgaacaagctgtctttacaggatggacataaagccaaa
aaaccagcatgtaaatttgaagagggtcaagatgtcttagctagatggtcagatggcttg
ttttatcttggaactatcaaaaagataaacattttgaaacagagctgcttcatcacattt
gaggacagttctaagtcctgggttctctggaaggacatccaaacaggagccactgggagt
ggggaaatggtctgtacaatatgtcaagaagagtattcagaagcacctaatgaaatggtt
atctgtgataagtgcggtcaaggatatcatcagctgtgtcatacgcctcatattgactcg
agtgtgatcgattcagatgaaaagtggctttgtcgacagtgcgtttttgcaacaacaaca
aagaggggtggtgcacttaagaaaggaccaaatgccaaagcactgcaagtcatgaagcag
acattaccctatagcgtggctgaccttgaatgggatgcaggtcataaaaccaacgttcag
cagtgctactgctactgtggaggccctggagactggtatttaaagatgctgcagtgctgc
aaatgtaagcagtggtttcatgaggcttgtgtccaatgccttcaaaagccaatgctgttt
ggagataggttttatacatttatttgctctgtctgcagttctggaccagaatacctcaaa
cgtctaccattacagtgggtagatatagcacacctatgcctttacaacctaagtgttatt
cacaagaagaagtactttgactctgaacttgagcttatgacatacattaatgacaactgg
gacagattgcaccctggagagctggcagacacgcccaaatctgaaagatatgagcatgtt
ctggaggcattaaatgattacaagaccatgtttatgtctgggaaagaaataaagaagaag
aagcatttgtttgggttgcgaattcgtgttcctcctgtgccaccaaatgtggctttcaaa
gcagagaaagaacctgaaggaacatcccatgaatttaaaattaaaggcagaaaggcatcc
aaacctacatctgactccagggaagtaagcaatgggatagaaaaaaaaggaaagaaaaaa
tctgtaggtcgtcctcctggcccatatacaagaaaaatgattcagaaaactgctgagccg
cctttgggtaaggaatcagtttcagagaatcctgcgttggatttaccttgttctataggg
agaactgagggagttgcacattcatccaatacctcagatgtggacctcacgggtgcttcc
agtgcaaaagaaactacctcgtctagcattcccaggcattatgggttatctgactctaga
aaaagaactcgcacgggaagatcgtggcctgcttcaataccacatttgcggagaagaaga
ggtcgccttccacgaagagcactccatactcagaactcagaagttgtaaaagatgatgaa
ggcaaagaagattaccagtttgaagaacttaacacagaaatcctgaataacttagcagat
caggagttacagctcaatcacctgaaaaactccatcactagttattttggtgccgcaggt
agaatagcatgtggagagaaataccgggttctggctcgccgcgtgacgctggatggaaag
gtgcagtatctcgtggagtgggaaggagcgactgcatcctga

DBGET integrated database retrieval system