KEGG   Rattus norvegicus (rat): 360937Help
Entry
360937            CDS       T01003                                 

Gene name
Tbc1d1
Definition
(RefSeq) TBC1 domain family member 1
  KO
K18341  TBC1 domain family member 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    360937 (Tbc1d1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    360937 (Tbc1d1)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    360937 (Tbc1d1)
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    360937 (Tbc1d1)
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    360937 (Tbc1d1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RabGAP-TBC DUF3350 PID CCD48
Motif
Other DBs
NCBI-GeneID: 360937
NCBI-ProteinID: XP_001071842
RGD: 1304562
Ensembl: ENSRNOG00000002180
UniProt: D4AC16
Position
14p11
AA seq 1257 aa AA seqDB search
MEAITFTARKHPFPNEVSVDFGLQLVGSLPVHSLTTMPMLPWVVAEVRRLSGQCSKKEPG
MKQVRLWVSPSGLRCEPDLRKSQPWDPLICSSIFECKPQRVHKLIHNSQDPSYFACLIKE
DAAHQQSLCYVFKADDQTKVPEIISSIRQAGKIARQEELRCPSEFDDTFAKKFEVLFCGR
VTVAHKKAPPALIDECIEKFNHVSCGRRIDWDAPTGQPSAPGARPMRKSFSQPGLRSLAF
RKEFQDASLRSSTFSSFDNDIENHLIGGHNVVQPTDMEENRTMLFTIGQSEVYLISPDTK
KIALEKNFKEISFCSQGIRHVDHFGFICRECSGGGGAGFHFVCYVFQCTNEALVDEIMMT
LKQAFTVAAVQQTAKAPAQLCEGCPLQGLHKLCERIEGMNSSKTKLELQKHLTTLTNQEQ
AMIFEEVQKLRPRNEQRENELIISFLRCLYEEKQKEHSHTGEPKQTLQVAAENIGSELPP
SASRFRLDSLKNRAKRSLTESLESILSRGNKARGLQDHSASVDLDSSTSSTLSNTSKELS
MGDKEALPISESSFKLLGSSDDLSSDSESHIAEESALLSPQQAFRRRANTLSHFPVECPA
PPEPAQTSPGVSQRKLMRYHSVSTETPHERNVDHLPGGESRCCPGQPSDPPPLPPRLNPS
ASSPNFFKYLKHNSSGEQSGNAVPKSVSYRNALRKKLHSSSSVPNFLKFLAPVDENNTCD
FKNTNRDFESKANHLGDTDGTPVKARRHSWRQQIFLRVATPQKACDSPSRYEDYSELGEL
PPRSPLEPVCEDGPFGPVQEEKKKTSRELRELWKKAILQQILLLRMEKENQKLQASENDL
LNKRLKLDYEEITPCLKEVTTVWEKMLSTPGRSKIKFDMEKVHSAVGQGVPRHHRGEIWK
FLAEQFHLKHPFPSKQQPKDVPYKELLKKLTSQQHAILIDLGRTFPTHPYFSAQLGAGQL
SLYNILKAYSLLDQEVGYCQGLSFVAGILLLHMSEEEAFKMLKFLMFDMGLRKQYRPDMI
ILQIQMYQLSRLLHDYHRDLYNHLEEYEIGPSLYAAPWFLTVFASQFPLGFVARVFDMIF
LQGSEVIFKVALSLLGSHKPLILQHENLETIVDFIKNTLPNLGLVQMEKTISQVFEMDIA
KQLQAYEVEYHVLQEELIDSSPLSDNQRMDKLEKTNSSLRKQNLDLLEQLQVANARIQSL
EVTVEKLLTSESKLKQAVLTLEMERSALLQMVEELRRQMAQPSTAEPDCTRLEPTGD
NT seq 3774 nt NT seq  +upstreamnt  +downstreamnt
atggaggcaatcacattcacagcgaggaagcatccgttccctaacgaggtttcggtggac
ttcggcttgcagctagtgggctccttacccgtgcattctctcactacaatgcccatgctg
ccgtgggtggtagccgaggtacgaagactcagtggccagtgctccaaaaaggagcctggg
atgaagcaagtccgcctttgggtttcgccctccggactacggtgcgaacctgacctgagg
aaaagtcaaccgtgggaccccctgatctgttccagcatctttgagtgcaagcctcagcgt
gttcacaaactgattcacaacagtcaggacccgagctacttcgcttgtctcattaaggag
gacgctgcccaccagcagagcctctgctatgtatttaaagcagatgatcaaacaaaagtg
cctgagatcattagctccatccggcaggcagggaagattgcccgccaggaagagctgcgc
tgcccctcggagttcgatgacaccttcgccaaaaagtttgaggtgctcttctgtggccgg
gtcactgtggcccacaagaaggcaccacctgcactgatcgacgagtgtatcgagaagttc
aaccatgtgagctgtggccgcagaatagactgggatgcgcccacggggcaaccatcagcg
cctggggcccggcccatgcgcaaatccttctcacagcctggactgcgctcgctggccttc
aggaaggagttccaggatgctagcctccgcagtagcacctttagctccttcgataacgac
atcgaaaatcacctaatcggcgggcacaatgtagttcagcccacagacatggaggagaac
cgaactatgctcttcacgattggccaatctgaagtttacctcatcagtcctgacaccaaa
aagattgcattggagaaaaattttaaggagatatccttttgctctcagggcatcaggcac
gtggaccactttggatttatctgccgagagtgctcaggtggcggtggcgccggctttcat
tttgtctgttacgtgttccagtgcacaaatgaagctctggttgacgagatcatgatgact
ctgaagcaggctttcacggtagctgcagtgcagcagactgctaaggcaccagcccagctg
tgtgagggctgccccttgcagggcctacacaagctctgcgagaggatagagggaatgaat
tcatctaaaaccaaattagaactccagaagcacctgaccacactgaccaatcaggagcag
gcaatgatatttgaggaagttcagaaattgagaccaagaaacgagcagcgagagaatgaa
ttaattatttcttttctgaggtgtttatacgaagagaaacaaaaggaacacagccatact
ggggagccaaagcagacactgcaggtggcagcagagaatattgggagtgaactaccaccc
agtgctagccggttcaggttagattcactgaagaacagagcaaagaggtccttaacagag
tccttagagagcattctgtcccggggcaataaagccaggggccttcaggaccattccgcc
agtgtggatctggacagctccacttctagtactctaagtaacaccagcaaagagctgtcc
atgggtgacaaggaggccttgcccatctctgaaagctccttcaaactccttggctcctca
gatgacctatccagtgactcagagagccacattgcagaagagtctgctctgttgtcaccc
cagcaggcattcagaaggagagccaacaccctgagtcatttcccagttgagtgccctgca
cctccagaacctgcccagacctctccaggggtgtctcaaagaaaactcatgcggtatcac
tccgtgagcacagagacgcctcatgaacgcaatgtggaccatcttcctgggggtgagtct
cggtgctgcccagggcagccttcagatccgcctcctcttccccctcgtcttaacccttcc
gcctcctcaccaaacttttttaagtacctaaaacacaattccagtggagaacagagtgga
aatgctgtgccaaaaagtgtctcctaccgtaatgccctgcggaaaaaactccattcttcc
tcttctgtgccaaattttctaaaatttctggctcctgtagatgaaaataacacctgtgac
tttaagaacacaaacagggactttgaatccaaagcaaaccacctgggtgacacagatggg
accccagtgaaggcccggcggcattcatggagacagcagatattcctccgagtggccact
ccacagaaggcttgtgattctccaagcagatatgaagattattcagagctgggagagctc
cctccacgttcccctttagaaccagtgtgtgaagatggaccatttggtccagtacaagag
gagaagaagaaaacgtctcgtgagcttagagagctgtggaaaaaggccatcttgcagcag
atcctgctgctgaggatggagaaggagaaccagaagctacaagcctctgagaatgatttg
ctgaacaaacgcctgaagcttgattatgaggaaatcactccttgtcttaaagaagtaact
acagtgtgggaaaagatgcttagcactccaggaagatccaaaattaagtttgatatggaa
aaagtgcactcagctgttgggcaaggtgtgccacgtcatcaccggggtgagatctggaag
tttctagctgagcagttccaccttaaacatccatttcccagtaaacagcagccaaaggat
gtgccctacaaagagctcttgaagaagctgacctcccagcagcacgccatcctcattgac
ctcgggcgaacctttccaacacatccatacttctctgcccagcttggagcaggtcagctg
tcactttacaacattctgaaggcctactcacttctggaccaggaagttggatactgtcaa
ggtctcagcttcgtggcaggcattttgctccttcatatgagtgaggaagaagcattcaag
atgctcaagttcctgatgtttgacatggggctgcggaaacagtatcggccagacatgatt
attttacagatccagatgtaccagctgtcacggctcctccatgattaccacagagacctc
tacaaccacctggaagagtatgagatcggccccagcctctacgcagctccctggtttctc
accgtgttcgcctcacagttcccacttggctttgtagccagagtctttgatatgatcttc
cttcagggatcagaggtcatatttaaagtagctttaagtcttttggggagccataaaccc
ttgattctgcagcatgagaacctggaaaccatagtggacttcataaagaacacactcccc
aacctaggcttggtgcagatggagaagaccatcagtcaggtgtttgagatggacatcgcc
aaacagctacaagcctatgaggttgagtaccatgtgctccaagaagaacttattgattcc
tctcctctcagtgacaaccaaagaatggataaattggagaaaaccaatagcagcttgcgc
aaacagaaccttgacctcctggaacaattgcaggtggcaaatgctaggatccaaagcctc
gaagtcacggtggagaagcttcttaccagcgagagtaagctgaaacaggctgtgctgacc
ctggagatggagcgctccgccctgctgcagatggtggaggagctacggaggcaaatggcc
cagcccagcactgcagagccggactgcacccggctggaacctacaggtgactga

DBGET integrated database retrieval system