KEGG   Rattus norvegicus (rat): 360949Help
Entry
360949            CDS       T01003                                 

Gene name
Cpeb2
Definition
(RefSeq) cytoplasmic polyadenylation element binding protein 2
  KO
K02602  cytoplasmic polyadenylation element-binding protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04114  Oocyte meiosis
rno04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    360949 (Cpeb2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    360949 (Cpeb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    360949 (Cpeb2)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     360949 (Cpeb2)
   Factors involved in mRNA localization
    Trans-acting binding proteins
     360949 (Cpeb2)
   mRNA cycle factors
    P-body specific factors
     360949 (Cpeb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_7 CEBP_ZZ RRM_1
Motif
Other DBs
NCBI-GeneID: 360949
NCBI-ProteinID: XP_008764431
RGD: 1307485
UniProt: G8EXB8
Position
14q21
AA seq 746 aa AA seqDB search
MRDFGFGVLHTALLRSGSPRSSPGGSAYRPFAAGPSATPFGPLSPPPLPVTGFSEAASPF
AIPSGGGAASSAAASSSSPLVAHQQAVQDELLLGLTQQPARPLSGAAAAEQLPSHHPGGG
TNAGVTHLLPSQDFKPSLHHPSSSSASSCCCCRTSSPQDFSKRQQQQLSSQKRKELSPPH
RPHPPDAKPTPPPLHCPGGGGGFGGPFSAPAVPAPPAMNLPQQQPPPAAPQQPQSRRSPV
SPQLQQQHQAAAAAFLQQRNSYNHHQPLLKQSPWSNHQSSGWGTASMSWGAMHGRDHRRS
GNMGIPGTMNQISPLKKPFSGNVIAPPKFTRSTPSLTPKSWIEDNVFRTDNNSNTLLPLQ
VRSSLQLPAWGSDSLQDSWCTAAGTSRIDQDRSRMYDSLNMHSLENSLIDIMRAEHDPLK
GRLSYPHPGTDNLLMLNARSYGRRRGRSSLFPIDDSLLDDGHSDQVGVLNSPTCYSAHQN
GERIERFSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQ
EESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIF
VGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARF
VQLQHGDIDKRVEVKPYVLDDQMCDECQGARCGGKFAPFFCANVTCLQYYCEFCWANIHS
RAGREFHKPLVKEGADRPRQIHFRWN
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgcgggacttcgggttcggggtgctgcacactgccctgctgcgcagcggcagcccccgg
tcctcgcccggcggcagcgcctaccggcccttcgccgccgggccgtccgccacgcccttc
ggcccgctgtcgccgccgccgttgcctgtcaccggcttctccgaggccgcctcccccttc
gccatcccctcgggcggcggcgcggccagctcagccgcagcttcctcttcctccccgctc
gtggcgcatcagcaggccgtgcaggatgagctgctgctcgggctgacacagcagccggcg
aggccgctctcgggggcggcggccgcagagcagctccccagccaccaccccggcggcggc
acgaacgcgggtgtgacccacctcctcccctcccaggacttcaaaccgagtctgcaccac
ccctcctcctcctccgcctcctcctgctgctgctgccgcacctcctccccgcaggacttc
agtaagcggcagcagcagcagctgagcagccagaagaggaaagagttgagtccgccacac
cgtccccaccctccggacgcgaagccgacgccgccgccgctccactgccccggcggtggc
ggcggcttcggcggcccgttctctgctcccgcggtgcccgcgccgcccgccatgaattta
cctcaacagcagccgccgccggcagcgccgcagcagccgcagagccggaggtcacccgtc
agcccgcagctgcagcagcagcaccaggcagccgcagccgccttcctgcagcagaggaac
tcgtacaaccaccaccagcctcttctgaaacaatctccttggagcaaccatcagagcagt
ggttggggcactgcaagcatgtcctggggagcaatgcatggcagagatcaccgtagaagc
ggaaacatgggaattccagggactatgaatcagatatctccgttgaagaaaccgttttcg
ggtaatgttatagcaccaccgaaattcactcgctctactccatcactgactccaaaatct
tggattgaagataatgtgttcaggacagacaacaatagtaacacactcttacccttacag
gtgagatctagtttgcagttgccagcttggggctcagattcactccaagatagttggtgc
actgcagccggaacatccagaatagaccaggatcgaagtaggatgtatgatagcttgaat
atgcactctctggaaaattcccttattgatatcatgagagcagagcacgatcctctcaag
ggtcgtttgagctatcctcatccaggaaccgacaatctgttaatgttaaatgcaaggagt
tatgggcgaagacgaggtcgatcttccctatttccaatagatgatagcttgttggatgat
ggtcacagtgatcaagttggtgtgttaaattcaccaacatgttattcagctcatcaaaat
ggagaacgaatagaacgcttctctcgaaaagtttttgttggagggcttcctccagatatt
gatgaagatgagatcactgccagcttccggagatttggacctttggtagtagattggccc
cataaagcagaaagcaagtcctatttcccaccaaaaggctacgccttcctcctctttcaa
gaggagagctcggttcaggcactcattgacgcttgcattgaagaagatgggaagctctac
ctgtgtgtctccagccctactatcaaagacaaacctgttcaaatccgtccttggaattta
agtgatagtgattttgtcatggatggttctcagcctttggatccccgaaaaacaattttt
gttggaggtgttcctaggccattaagggctgtggaacttgctatgatcatggaccggctg
tatggtggtgtgtgttacgcaggaatcgatacagatccagaactcaaatacccgaaaggt
gctgggcgagtggctttctccaatcagcagagctacattgctgccatcagtgctcggttt
gttcagcttcagcatggtgacattgataaacgcgtggaggtgaagccatatgtgctagat
gaccagatgtgtgacgagtgccagggtgcgcgctgcggtgggaaatttgccccctttttc
tgtgccaatgtcacctgcctgcagtattactgtgagttttgttgggcaaatatccactct
cgtgcgggacgcgagttccataagccattggtgaaggaaggtgctgatcgcccgcgtcag
atccacttccgctggaactaa

DBGET integrated database retrieval system