KEGG   Rattus norvegicus (rat): 360955
Entry
360955            CDS       T01003                                 

Gene name
Man2b2, Ab2-450
Definition
(RefSeq) mannosidase, alpha, class 2B, member 2
  KO
K12312  epididymis-specific alpha-mannosidase [EC:3.2.1.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00511  Other glycan degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    360955 (Man2b2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.24  alpha-mannosidase
     360955 (Man2b2)
SSDB
Motif
Pfam: Glyco_hydro_38N Glyco_hydro_38C Alpha-mann_mid Glyco_hydro38C2
Other DBs
NCBI-GeneID: 360955
NCBI-ProteinID: NP_001128443
RGD: 1308840
Ensembl: ENSRNOG00000061779
Vega: OTTRNOG00000001796
UniProt: B5DEJ3
Position
14q21
AA seq 1004 aa
MGPLRWLPLLGQLLLLWPLAARPASPIRAFVVPHSHMDVGWVYTVQESMRAYAANVYTTV
VEELVRGRQRRFIAVEQEFFRLWWDGVASEQQKQQVRQLLDEGCLEFVLGGQVMHDEAVT
HLDDQILQLTEGHGFLYETFGIRPQFSWHVDPFGASATTPTLFSLAGFNAHLISRIDYDL
KDAMQEAQGLQFVWHGSPSLSEQQEIYTHVMDLYSYCTPSHIPFSNRSGFYWNGVAVFPE
PPPDGVYPNMSEPVTVDNIHLYAEALVANIKQRAAWFRTPHVLWPWGCDKQFFNASVQFD
NMDPLLEYINNRSAQFGISVQYATLNDYFQALHDFNVTWDIRDHHDFLPYSSEPQQAWTG
FYTSRSTLKGLARQASALLYAGESMFTRYMWPHPRGTLDPTWALQQLQQLRWAVSEVQHH
DAITGTESPKVKNMYMEHLSMGMRGVHKLMASIALDRSPGSGTDTRPVGYSASVYNPLAW
KITTIITLTVAFPSVSVTDELGRPVSAQIQNSTKDPSAYDLLILTTIPGLSYRYYKVRRI
LGDQAGTRELVTPRANTLKFSRKLRNQTSQEGKLLVPVMNDCYTLLFDQDTNMLHSIQDR
QSNRTVHMTQEFLEYRANGDVKQGPISDNYLFASNDTAEPSWEAVGMEMVVGTLATDVRQ
YFYRNITDQGYIYSIHTRLAHVHPSLAGELLCRRIEQQYQVGPLDLNREAILRTSSDLNS
QQVLYSDNNGYQMQRRPYKAFKSNPIPRNYYPMVQSAFIEDDKSRLVLLAERPHGVSSQE
NGQVEVMLHRRLWNNLVWDLNYNLTLNDTSVVHPVLWLLLGPKSTTTALRPRSGVALQHR
PVVLLKELTDEEETAIHRPHHPWPVTLPPSLHLQVLSLRGWQYSRNHAQHLKNLQRGHPE
KPQVNLQRVLLRLHHLYEAGEDPVLSRPATVDLKIALRGLGSVVAVEERSLTGTWDVQTL
QRWHWRTKIGQLKGHPTSPPRSPGGSIITVYPKEIRTFFIYLQQ
NT seq 3015 nt   +upstreamnt  +downstreamnt
atggggccgctgcgctggctgccgctgctcggccagctattgctgctgtggccgctggcg
gcccggcccgccagccccatccgggcctttgtggtgccccacagtcacatggacgtgggc
tgggtctacacggtccaggaaagcatgcgggcctatgcagccaatgtctacaccaccgtg
gtggaggaactggtccgaggcaggcagcgccgcttcatcgctgtggagcaggagttcttc
cggctgtggtgggatggtgtagcctctgagcagcagaaacagcaggtccgccagctcctg
gatgaaggatgcctggagttcgttcttggaggccaggtcatgcatgacgaggctgtgacc
cacctggatgaccagatcctacagctcacagaaggacatggctttctctacgaaacgttt
ggaatccggccacagttctcctggcacgtggacccctttggtgcatcagcgacgacccct
accctattttccctggccggcttcaatgcccacctcatctcccggattgactacgacctc
aaggatgccatgcaggaagctcaggggctacagttcgtgtggcacgggtccccatctctg
tcagagcagcaggagatctacacccacgtcatggacctttatagctactgcaccccctca
cacatccctttctctaacaggtctggattttactggaatggtgtggccgtcttcccagag
ccacccccagatggcgtgtatcctaacatgagtgaacctgtcaccgtagacaacatccac
ctctacgctgaggctctggtggccaacattaaacagagggccgcatggttccggactccc
cacgtcctctggccctggggatgtgacaagcagttcttcaacgcctcggtgcagtttgac
aacatggaccccctgctggagtacattaacaaccgctctgcccagtttggcatctcagtg
cagtacgccacactgaatgattacttccaggccctgcacgacttcaacgtgacctgggac
atccgagaccaccatgacttcctaccctattcttcagagccacagcaggcctggaccgga
ttctacacatcccggagcactctcaagggtctagcgagacaagccagtgccttgctatat
gctggggagtccatgttcacacgctatatgtggccacacccccgtggaactctggaccct
acctgggccctgcagcagctccaacagcttcgctgggccgtgtctgaggtccagcaccac
gatgccatcacaggcactgaatcccccaaggtgaaaaacatgtacatggaacatctcagc
atggggatgcgaggtgtacataagctgatggcctccattgccctggacaggtccccaggg
tctggcacagacacgaggcctgtgggatactctgcctctgtgtacaacccgctagcctgg
aagatcactaccattatcaccctgactgtcgctttccccagtgtcagcgtcacagatgag
ttgggccgtccagtgtcagcacagattcagaactcgacaaaggacccttctgcgtatgac
ctgctcatcctgaccaccatcccaggcctcagctaccggtactacaaagtcaggcgcata
ctcggggaccaggcaggcaccagagagctggtcacccccagggccaacaccctcaagttt
agtcgcaaactgaggaaccagaccagccaggaaggcaagctcctggtgcctgtaatgaat
gactgctacactttgctgttcgaccaggacaccaacatgttacatagcattcaggacaga
cagagtaaccgcacagtgcacatgacccaagagttcctggagtatcgagccaacggggac
gtgaagcagggccccatttctgacaactacctctttgcatccaacgataccgctgagcct
tcctgggaagcggtggggatggagatggtggtgggcacgctggccacggacgtaaggcag
tatttctacaggaacataacagaccagggttacatctattcgatccacactcgtctggcc
catgtgcatccgagccttgctggggaactgctctgccgacggatagagcagcagtaccaa
gtgggccccctggacctaaaccgtgaggccatcctgaggaccagcagtgacctaaacagc
caacaagtcctctactctgacaacaatggctaccagatgcagcggaggccctacaaggct
ttcaagagcaatcccatcccccggaattactaccccatggtacagtcggccttcatcgag
gatgacaagagcaggctggtgctgctggcagagcgaccgcatggtgtctccagccaagag
aatgggcaggtggaggtaatgctccatcggcggctgtggaacaacctggtctgggacctg
aactacaacctcacactgaatgacacctctgtcgtccacccagtgctctggcttctgctg
gggcccaagtccaccacaactgccctgcgcccgaggagtggggtggccctccagcacagg
cctgtcgtgttgttaaaagagctaactgatgaagaagagacagccattcacagaccccat
cacccctggcctgtgacattgcccccaagcctgcacctgcaggtcctcagcttacgtggc
tggcagtacagcaggaaccatgcccagcacctgaagaaccttcagagaggccacccagag
aaaccacaggtcaacctacaacgtgtgctgctgcgcctgcaccacctgtatgaagcaggg
gaggacccggtactgtctcggcctgctacagtggatctcaagattgcacttcgaggacta
gggtctgtagtggccgtggaggaacgctcactcacagggacctgggatgtgcagacgctg
cagcgctggcactggaggacaaagattggccagctaaaagggcaccctacctctccacca
aggtcaccaggaggctccatcatcactgtgtaccccaaggaaatccggaccttcttcatt
tacctccagcagtga

DBGET integrated database retrieval system