KEGG   Rattus norvegicus (rat): 360968Help
Entry
360968            CDS       T01003                                 

Gene name
Tbc1d10a, Tbc1d10
Definition
(RefSeq) TBC1 domain family, member 10a
  KO
K19944  TBC1 domain family member 10
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    360968 (Tbc1d10a)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    360968 (Tbc1d10a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RabGAP-TBC
Motif
Other DBs
NCBI-GeneID: 360968
NCBI-ProteinID: NP_001015022
RGD: 1311641
Ensembl: ENSRNOG00000006394
UniProt: Q587K3
Position
14q21
AA seq 505 aa AA seqDB search
MAKSSRENGPRAPASGGSLSGTRESLAQGPDAATADELSSLGSDSEANGFAERRIDKFGF
IVGSQGAEGALEEVPLEVLRQRESKWLDMLNNWDKWMAKKHKKIRLRCQKGIPPSLRGRA
WQYLSGGKVKLQQNPGKFDELDMSPGDPKWLDVIERDLHRQFPFHEMFVSRGGHGQQDLF
RVLKAYTLYRPEEGYCQAQAPIAAVLLMHMPAEQAFWCLVQVCEKYLPGYYSEKLEAIQL
DGEILFSLLQKVSPVAHKHLSRQKIDPLLYMTEWFMCAFARTLPWSSVLRVWDMFFCEGV
KIIFRVGLVLLKHALGSPEKLRACQGQYETIEQLRSLSPKIMQEAFLVQEVIELPVTERQ
IEREHLIQLRRWQETRGELECRSPPRMHGAKAILDAEPGPRPALQPSPSIRLPPDAALPS
SKTKPHKQAQKEQKRTKTSGQPDKSPGLNQATVVTASGDACPPQDAPPKDPVSQDPAPQD
STPQNLAYHHSQESLTSQESEDTYL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaagcagcagagagaatgggccgcgcgcgcccgcatcgggcgggagcctgtcc
gggacccgagagagcctggcccagggccccgacgccgccactgccgatgagctaagctcc
ctgggctccgactcggaggccaacggcttcgccgagcgccgcatcgacaagtttggcttc
atcgtgggttcgcagggcgctgagggcgcgctggaggaagttcccctggaggtgctgagg
cagagggagtccaagtggctggacatgctcaacaactgggacaaatggatggccaagaag
cacaaaaagattcgtcttcgatgccagaagggcatcccaccttctctgcggggacgagct
tggcaatacctgtcaggaggcaaggtgaaacttcagcagaatcctggaaaatttgatgag
ctggacatgtctcctggggaccccaagtggttggatgtgattgagcgtgacctgcaccgg
cagttccctttccatgagatgttcgtgtcccggggaggccacggccagcaggacctgttc
cgtgtactgaaggcctacacgctgtaccgccctgaggagggctactgccaggcccaggcg
cccattgctgcggtgctgctcatgcacatgcctgctgagcaagccttctggtgtctggtc
caagtctgtgagaagtacctgcctggctactacagtgagaaactggaggcaatccagctg
gatggcgagatcctcttctcactgctacagaaggtgtcccctgtggctcacaagcacctt
agccgccagaagattgaccccctgctgtacatgacggagtggttcatgtgtgcttttgcc
cgcacgctcccctggagctctgtgctgcgagtttgggacatgttcttctgtgaaggagtc
aagatcatcttccgcgtggggctggtactgctgaagcatgccctaggctccccagagaaa
ctccgagcctgccagggccagtatgaaaccatcgagcagctgcggagcctcagccccaag
atcatgcaggaagccttcctggttcaggaggtgatagagttgcctgtgacggagcgccag
attgagcgggagcacctcatccagctgcggcgctggcaagagacccgcggtgagctggag
tgtcgctctccacccaggatgcatggtgccaaggccatcctggatgcagagcctggtccc
cgacctgccctgcaaccttcaccatccatccgcctgcccccagatgcagccctccccagc
tccaagactaagccacacaagcaggcccagaaggagcagaagcggacaaagaccagtggg
caaccggacaagtccccaggcctcaatcaagccacagtggtgactgcttcaggagatgca
tgtcctcctcaggatgcgcccccaaaggatccagtctcccaggacccggctccccaggac
tctactcctcagaacttagcctaccaccattcccaagagagcctgacctcccaggagagt
gaggacacctacttgtaa

DBGET integrated database retrieval system