KEGG   Rattus norvegicus (rat): 360971
Entry
360971            CDS       T01003                                 
Symbol
Nipsnap1
Name
(RefSeq) protein NipSnap homolog 1
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: NIPSNAP DUF2748
Other DBs
NCBI-GeneID: 360971
NCBI-ProteinID: NP_001094200
RGD: 1310419
Ensembl: ENSRNOG00000008374
UniProt: G3V728 Q5EBA4
Position
14:79734234..79758101
AA seq 284 aa
MAPRLCIISAAARRLLRKPGPCVGDLAAARAVRFYSKDSEGSWFRSLFVHKVDPRKDAHS
TLLSKKETSNLYKIQFHNVKPECLDAYNSLTEAVLPKLHLDEDYPCSLVGNWNTWYGEQD
QAVHLWRFSGGYPALMDCMNKLKTNKEYLEFRKERSKMLLSRRNQLLLEFSFWNEPQPRA
GPNIYELRTYKLKPGTMIEWGNNWARAIKYRQENQEAVGGFFSQIGELYVVHHLWAYKDL
QSREETRNAAWRKRGWDENVYYTVPLVRHMESRIMIPLKISPLQ
NT seq 855 nt   +upstreamnt  +downstreamnt
atggctccgcggttgtgcatcatctctgcagcagcacggcggctgctaaggaagccggga
ccctgtgttggggacctcgcggctgcgcgtgctgtgcgattctattccaaggacagtgaa
ggcagctggttccgctccctctttgttcacaaggtggatcctcggaaggacgcccactcc
actctgctgtccaagaaggagactagtaatctctacaagatccagtttcacaacgtgaag
cccgaatgtctggatgcctacaacagtctgacggaggctgtgctgcccaagctgcacctg
gatgaggactacccctgctcgcttgtgggcaactggaacacgtggtacggggagcaggac
caggcagtacacctatggcggttctcaggtggctatccggccctcatggactgcatgaac
aagctaaaaaccaacaaggagtacctagagttccggaaggagcggagcaagatgctgctg
tccaggagaaaccagttgcttctggaattcagcttctggaatgagccacagccccgagct
ggccccaacatctatgagctgagaacatacaagctcaagccgggaaccatgatcgagtgg
ggaaacaactgggctcgggccatcaagtaccgtcaggagaaccaggaggcggtgggaggc
ttcttttcacaaataggagagctctacgtggtacaccacttatgggcctacaaagatctg
cagtctcgggaggagactcgaaatgcggcctggagaaagaggggctgggatgaaaatgtg
tactatacagtccctttggttcgacacatggagtcacgaatcatgatccccctgaagatt
tctcctctccagtga

DBGET integrated database retrieval system