KEGG   Rattus norvegicus (rat): 360971Help
Entry
360971            CDS       T01003                                 

Gene name
Nipsnap1
Definition
(RefSeq) nipsnap homolog 1 (C. elegans)
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: NIPSNAP DUF2748
Motif
Other DBs
NCBI-GeneID: 360971
NCBI-ProteinID: NP_001094200
RGD: 1310419
Ensembl: ENSRNOG00000008374
UniProt: G3V728 Q5EBA4
Position
14q21
AA seq 284 aa AA seqDB search
MAPRLCIISAAARRLLRKPGPCVGDLAAARAVRFYSKDSEGSWFRSLFVHKVDPRKDAHS
TLLSKKETSNLYKIQFHNVKPECLDAYNSLTEAVLPKLHLDEDYPCSLVGNWNTWYGEQD
QAVHLWRFSGGYPALMDCMNKLKTNKEYLEFRKERSKMLLSRRNQLLLEFSFWNEPQPRA
GPNIYELRTYKLKPGTMIEWGNNWARAIKYRQENQEAVGGFFSQIGELYVVHHLWAYKDL
QSREETRNAAWRKRGWDENVYYTVPLVRHMESRIMIPLKISPLQ
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggctccgcggttgtgcatcatctctgcagcagcacggcggctgctaaggaagccggga
ccctgtgttggggacctcgcggctgcgcgtgctgtgcgattctattccaaggacagtgaa
ggcagctggttccgctccctctttgttcacaaggtggatcctcggaaggacgcccactcc
actctgctgtccaagaaggagactagtaatctctacaagatccagtttcacaacgtgaag
cccgaatgtctggatgcctacaacagtctgacggaggctgtgctgcccaagctgcacctg
gatgaggactacccctgctcgcttgtgggcaactggaacacgtggtacggggagcaggac
caggcagtacacctatggcggttctcaggtggctatccggccctcatggactgcatgaac
aagctaaaaaccaacaaggagtacctagagttccggaaggagcggagcaagatgctgctg
tccaggagaaaccagttgcttctggaattcagcttctggaatgagccacagccccgagct
ggccccaacatctatgagctgagaacatacaagctcaagccgggaaccatgatcgagtgg
ggaaacaactgggctcgggccatcaagtaccgtcaggagaaccaggaggcggtgggaggc
ttcttttcacaaataggagagctctacgtggtacaccacttatgggcctacaaagatctg
cagtctcgggaggagactcgaaatgcggcctggagaaagaggggctgggatgaaaatgtg
tactatacagtccctttggttcgacacatggagtcacgaatcatgatccccctgaagatt
tctcctctccagtga

DBGET integrated database retrieval system