KEGG   Rattus norvegicus (rat): 360973Help
Entry
360973            CDS       T01003                                 

Gene name
Gas2l1
Definition
(RefSeq) growth arrest-specific 2 like 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: GAS2 CH
Motif
Other DBs
NCBI-GeneID: 360973
NCBI-ProteinID: NP_001101835
RGD: 1311206
Ensembl: ENSRNOG00000009040
UniProt: D3ZR69
Position
14q21
AA seq 428 aa AA seqDB search
MADPVAGIAGSAAKSVRPFRSSEAYVEAMKEDLADWLNALYSLGLPGSGDGFLTGLATGT
TLCQHANAVTKAARALAAARPTRGVAFQAHSVAPGSFMARDNVASFIGWCRAELGVPEVL
MFETEDLVLRKNEKSVVLCLLEVARRGARLGLLAPRLVQFEQEIERELRATPQASSVPAA
EEDVTEIAAAPGAPARTPRMTPNDIRNLDELVREILGKCTCPDQFPMIKVSEGKYRVGDS
SLLIFVRVLRNHVMVRVGGGWDTLEHYLDKHDPCRCTSSTHRLPQQRTGTFSPQRGSPTP
SPRPGSPVPGSERRSSRPEVTPISLRSTKEGPETPLRSPGFWNHLQVCELLLASRSRREW
INSAPSLNLTAGRKAGTCLAALPLGLCVLLGPAPEFSEVSFPSWAFLGVARSIVGGAPLG
PSECLCCF
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggcggacccagtggcgggcatcgcaggctccgccgccaagagtgtgcgacccttccga
tccagtgaggcctatgtggaagccatgaaggaagacctggccgattggctcaatgctttg
tatagtctaggtctacccggcagtggtgatggcttcctcacggggctggccacgggtaca
accctgtgccagcatgccaacgctgtcaccaaggctgcccgggctctggctgctgcccgt
ccaacccgaggtgtggccttccaggcacacagtgtggcgcctggctccttcatggcccga
gacaacgtggcctctttcatcggctggtgccgggctgagctgggcgtgcctgaagtgctc
atgtttgagacagaggacctggtgctgcgcaagaacgagaagagtgtggtgctgtgcctg
ttggaggttgcccgacgtggggcacgccttgggctgctcgccccgaggctggtacagttt
gagcaggagattgagcgggagcttcgggctacccctcaggcctccagcgtccctgctgct
gaagaggatgtcactgaaatcgctgctgcaccaggggcacctgcccgcacaccccgcatg
acgcccaatgacattcgaaacctggacgagctggtaagggagatcctgggcaagtgcacc
tgcccagaccagtttcccatgatcaaggtctccgaggggaagtaccgagtgggagactcc
agcttgctcatctttgtgagggtgctgaggaaccacgtgatggtgcgagtgggcggcggc
tgggacacactggagcactacctagacaagcatgacccttgccgctgcacttcttccacc
caccggctgccccagcagagaaccgggactttctctccgcagaggggatcacccactcct
agtccccgccccggtagcccagtccctggaagtgagcgccggagctcccggcccgaagta
actcccatcagcctgcgaagcacaaaggaggggcctgagaccccactcaggtctccaggc
ttctggaaccatttacaggtttgtgagctgcttttggcttcaagaagcagaagggagtgg
ataaactcagccccttcccttaacctcactgcagggagaaaggcaggcacctgcctggct
gctcttccactagggctgtgtgtgctcttaggcccagctccagagttctccgaggtttcc
tttcctagctgggctttcttgggagttgcaagaagcattgtgggtggggcacctctgggc
ccaagtgagtgtctgtgttgtttttga

DBGET integrated database retrieval system