KEGG   Rattus norvegicus (rat): 360975
Entry
360975            CDS       T01003                                 

Gene name
Ogdh
Definition
(RefSeq) oxoglutarate dehydrogenase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00020  Citrate cycle (TCA cycle)
rno01100  Metabolic pathways
rno01200  Carbon metabolism
Module
rno_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rno_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    360975 (Ogdh)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     360975 (Ogdh)
SSDB
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N GGA_N-GAT
Other DBs
NCBI-GeneID: 360975
NCBI-ProteinID: NP_001017461
RGD: 1561359
Ensembl: ENSRNOG00000005130
UniProt: Q5XI78
Position
14q21
AA seq 1023 aa
MFHLRTCAAKLRPLTASQTVKTFSQNKPAAIRTFQQIRCYSAPVAAEPFLSGTSSNYVEE
MYCAWLENPKSVHKSWDIFFRNTNAGAPPGTAYQSPLSLSRSSLATMAHAQSLVEAQPNV
DKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSSVPADIISSTDKLGFYGLHES
DLDKVFHLPTTTFIGGQEPALPLREIIRRLEMAYCQHIGVEFMFINDLEQCQWIRQKFET
PGIMQFTNEEKRTLLARLVRSTRFEEFLQRKWSSEKRFGLEGCEVLIPALKTIIDMSSAN
GVDYVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDMKYHLGMYHRRINR
VTDRNITLSLVANPSHLEAADPVVMGKTKAEQFYCGDTEGKKVMSILLHGDAAFAGQGIV
YETFHLSDLPSYTTHGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNSDDP
EAVMYVCKVAAEWRNTFHKDVVVDLVCYRRNGHNEMDEPMFTQPLMYKQIRKQKPVLQKY
AELLVSQGVVNQPEYEEEISKYDKICEEAFTRSKDEKILHIKHWLDSPWPGFFTLDGQPR
SMTCPSTGLEEDILTHIGNVASSVPVENFTIHGGLSRILKTRRELVTNRTVDWALAEYMA
FGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQNVDKRTCIPMNHLWPNQAPYTVCNSSL
SEYGVLGFELGFAMASPNALVLWEAQFGDFNNMAQCIIDQFICPGQAKWVRQNGIVLLLP
HGMEGMGPEHSSARPERFLQMCNDDPDVLPNLQEENFDISQLYDCNWIVVNCSTPGNFFH
VLRRQILLPFRKPLIVFTPKSLLRHPEARTSFDEMLPGTHFQRVIPEDGPAAQNPDKVKR
LLFCTGKVYYDLTRERKARDMAEEVAITRIEQLSPFPFDLLLKEAQKYPNAELAWCQEEH
KNQGYYDYVKPRLRTTIDRAKPVWYAGRDPAAAPATGNKKTHLTELQRFLDTAFDLDAFK
KFS
NT seq 3072 nt   +upstreamnt  +downstreamnt
atgtttcatttaaggacttgtgctgctaagttaaggccattgacagcctcccagactgtt
aagacattttcacaaaacaaaccagcagcaattaggacgtttcaacagattcggtgctat
tctgcacctgtagctgctgaaccatttcttagtgggactagttcgaactatgtggaggaa
atgtactgtgcctggttggagaatcccaaaagtgtacataagtcatgggacatttttttc
cgaaacaccaatgctggagccccaccgggcactgcctaccagagccccctttccctgagt
cgaagctccctggctaccatggctcatgcacagtccctggtggaagcacagcctaacgtc
gacaagctcgtggaggaccacttggcggtgcagtctctcatcagggcgtatcagatacga
gggcaccatgtagcacagctggaccccctggggattttggatgctgatctggactcctcc
gtgcccgctgacattatctcatccacagacaaacttgggttctatggcctacacgagtct
gaccttgacaaggtcttccacttacccaccaccactttcatcgggggacaggagccagca
cttcctcttcgggagatcatccgtcggctggagatggcctactgccagcacattggtgtg
gagttcatgttcattaacgatttggagcaatgccagtggatccggcagaagtttgagacc
cctgggatcatgcagttcaccaatgaggagaagcggaccctgctggccaggcttgtacgg
tccaccaggtttgaggagttcctgcagcgaaagtggtcctctgagaagcgttttggtctg
gaaggctgtgaggtgctgatccctgccctcaagacaatcattgacatgtcaagtgcaaat
ggagtggactatgtgatcatggggatgccacacagaggacgactgaacgtgctagccaat
gtcatcaggaaggagctggagcagatattctgtcagtttgactcgaagctggaggcagct
gatgagggttccggggacatgaagtaccacctgggcatgtatcaccgaaggatcaaccgt
gtgaccgacagaaacatcactctgtccttggtggctaacccttcccacttagaggctgct
gaccctgtagtgatgggaaagaccaaagctgaacagttctactgtggagacactgaaggg
aaaaaggtgatgtctatcctgctgcatggggatgctgcctttgctggccagggtatcgtg
tatgagaccttccatctcagcgacctgccatcctatacaacccacggcaccgttcacgtg
gttgtcaacaaccagattggcttcaccacagaccctcggatggcccgctcttctccctac
cccactgatgtggcccgagtggtgaacgcccccattttccatgtcaactcagatgaccct
gaagctgtcatgtatgtatgcaaggtggcagctgagtggagaaacaccttccacaaggat
gttgttgttgatctggtgtgttatcgacgaaatggccacaacgagatggatgaacctatg
ttcacacagccactcatgtacaagcagatccgtaagcagaagccggtactgcagaagtat
gcagaattgctggtatcccagggggtcgtcaaccagcccgaatatgaggaggaaatctcc
aagtacgataagatctgtgaggaagcatttaccagatccaaagatgagaagatcttgcac
atcaagcactggctggattccccctggcctggctttttcaccctggatggacagcccagg
agcatgacctgcccctccactggcctggaggaggacatcttgacccacattgggaatgtg
gccagttctgtacctgtggagaactttaccatccatggagggctgagccggatcttgaag
actcgcagagagcttgtgacaaaccggactgtggactgggccctggcagagtacatggcg
ttcggatcactcctgaaggaaggcatccatgtccggctgagtggccaggacgtggagcgg
ggtaccttcagccatcgccaccatgtgctccatgaccagaatgtggacaaaagaacctgc
atccccatgaaccacctttggcctaaccaggccccttacaccgtgtgcaacagctcgttg
tctgagtatggtgtcctgggctttgaactgggctttgccatggctagccctaatgctctg
gttctctgggaggcccagtttggtgatttcaacaacatggcacagtgcatcattgaccag
ttcatctgcccaggacaggcaaagtgggtgcggcagaatggcatcgtgctcctgctacct
cacggcatggaaggcatgggtcccgagcattcctctgcccgtccagagaggtttctgcag
atgtgcaatgatgacccagatgtcctgcctaacctgcaggaggaaaactttgacatcagt
cagctctacgactgcaactggattgtcgtcaactgctccacccctggcaacttcttccac
gtgctgcgacgacagatcttgctgcccttccggaagccgttaatcgtcttcactcccaaa
tccctcctgcgccaccctgaggcaagaactagctttgatgagatgctgccaggaacccac
ttccagcgtgtgatcccagaagatggacctgcagctcagaacccagacaaagtcaagagg
cttctcttctgcactggcaaggtgtactatgacctcacccgagagcgcaaagccagggac
atggcagaggaggtggctattacaaggattgagcagctgtcaccattccccttcgacctc
ctgctgaaagaggcacagaagtatcccaatgctgagctggcctggtgccaggaagagcac
aagaatcaaggctactatgactatgtcaagccaagacttcggaccaccattgaccgtgct
aagcctgtctggtatgctggccgagacccagcagccgctccagccactggcaacaagaag
acccacctgacagagctgcagcgctttctggacacagcctttgacctggacgccttcaag
aaattctcttag

DBGET integrated database retrieval system