KEGG   Rattus norvegicus (rat): 360994
Entry
360994            CDS       T01003                                 

Gene name
Chac2
Definition
(RefSeq) putative glutathione-specific gamma-glutamylcyclotransferase 2
  KO
K07232  glutathione-specific gamma-glutamylcyclotransferase [EC:4.3.2.7]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    360994 (Chac2)
Enzymes [BR:rno01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.7  glutathione-specific gamma-glutamylcyclotransferase
     360994 (Chac2)
SSDB
Motif
Pfam: ChaC GGACT
Other DBs
NCBI-GeneID: 360994
NCBI-ProteinID: NP_001020187
RGD: 1309120
Ensembl: ENSRNOG00000001531
UniProt: Q641Z5
Position
14
AA seq 178 aa
MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVTLVEDPGGSV
WGVAYKLPVGKEEEVKTYLDFREKGGYRTTTVIFYPKDSTTKPFSVLLYIGTCDNPNYLG
PAPLEDIAEQIFNAAGPSGRNTEYLFELADSIRKLVPEDADEHLFSLEKLVKERLEGK
NT seq 537 nt   +upstreamnt  +downstreamnt
atgtgggtgtttggttatgggtccctcatttggaaggtggacttcccctaccaggacaag
ctggttggttacatcacaaactacagccggcgcttctggcaaggcagcaccgaccaccgc
ggggtccccggcaagcctggaagagttgtgacccttgttgaagatcctgggggcagtgta
tggggtgttgcttacaaactaccagtcgggaaagaagaggaagtaaaaacataccttgac
ttcagagagaaaggaggctacagaactacaacagtcattttttatccaaaagattccaca
acaaaaccattcagtgttttgctctacattggaacatgtgacaatcctaactatcttgga
ccggcacctctggaagacattgctgaacaaatttttaatgcagctggtccaagtggaaga
aatacagaatatctttttgaacttgcagattctattaggaaacttgtgccagaagatgca
gacgagcatctcttctctttggaaaaattagtaaaggaacgcttagaaggaaaatag

KEGG   Rattus norvegicus (rat): 362196
Entry
362196            CDS       T01003                                 

Gene name
Chac1
Definition
(RefSeq) glutathione-specific gamma-glutamylcyclotransferase 1
  KO
K07232  glutathione-specific gamma-glutamylcyclotransferase [EC:4.3.2.7]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    362196 (Chac1)
Enzymes [BR:rno01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.7  glutathione-specific gamma-glutamylcyclotransferase
     362196 (Chac1)
SSDB
Motif
Pfam: ChaC GGACT
Other DBs
NCBI-GeneID: 362196
NCBI-ProteinID: NP_001166908
RGD: 1307153
Ensembl: ENSRNOG00000014387
UniProt: B3STU3
Position
3
AA seq 222 aa
MKQESAAQSTPPPSLSPAPSAQPSWEDGDPQALWIFGYGSLVWKPDFAYSDSRVGFVRGY
SRRFWQGDTFHRGSDKMPGRVVTLLEDHEGCTWGVAYQVRGEQVSEALKYLNVREAVLGG
YDTKEVTFYPQDTPDQPLTALAYVATPQNPGYLGPAPEEVIATQILACRGFSGHNLEYLL
RLADFMQLCGPQAQDEHLEAIVDAVGSLLPCSYLSEQPLALI
NT seq 669 nt   +upstreamnt  +downstreamnt
atgaagcaggagtccgcagcccagagcaccccgcctccttcactgtcccctgcaccatcc
gcgcagccttcctgggaggatggcgacccccaagccctgtggattttcgggtacggctcc
ctagtgtggaagcctgactttgcctacagcgacagccgtgtgggcttcgtacgtggctat
agccgacggttctggcagggagacaccttccacaggggcagcgataagatgcctggccga
gtggtgaccctccttgaagatcatgagggctgcacttggggtgtggcataccaggttcga
ggggagcaggtgagcgaggcactgaagtacctgaacgtgagagaagctgtgcttggtggc
tacgacactaaggaagtcaccttttatcctcaagacacccctgaccaacccctcacagca
ctggcctatgtggccaccccacagaaccctggctacctgggccctgctcccgaagaggtc
attgccacacagatccttgcttgccgaggcttctctggccacaaccttgaatacttgttg
cgtttggcagacttcatgcagctctgtgggcctcaggcacaagatgagcacctggaagcc
atcgtggatgccgtaggaagcttgctgccctgctcttacctctctgagcagcctctggca
ctgatctga

DBGET integrated database retrieval system