KEGG   Rattus norvegicus (rat): 360997Help
Entry
360997            CDS       T01003                                 

Gene name
Abcg3l4
Definition
(RefSeq) ATP-binding cassette, subfamily G (WHITE), member 3-like 4
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: ABC2_membrane ABC_tran
Motif
Other DBs
NCBI-GeneID: 360997
NCBI-ProteinID: NP_001032282
RGD: 1588538
UniProt: Q498U1
Position
14p22
AA seq 652 aa AA seqDB search
MSSSNDPTVIPMTERRHSDLPETNTSDPETLTGEAVVLSFHNISYIETVQSGFPLCQKTR
VMERLSSISGIMGPGLNAIMGPQDGSRSLLLDVLAARRHPSGLSGDILVNGKPRPANFKC
TSGYVPHNDVVMHTVTVRDNLEFSAALCLPMTITRDEKRRRINEVLELLHLDEKQNTKPR
SKELRKRTSIAVELIADHPILFLDNPTTYLDFTTTTYVISVLRRMSMKGKTIIFSINQPQ
YSIFRFFDSLTLMASGKLMFHGPARDALEYFTSAGYPADFFLDIINGGFCDTEEDGHEVG
NYEELFERQYQATKKLVNMYAQSRLHSDTRARLDQILGQQQLDRNSAVETTCATPFWHQL
MWITYRSFKNIWGFPWATVIQAVIIAILAALIGIAFQVLKNDCNEVRIRAGLLYLLTIFQ
SLTSVFAGVLFVINRHRFLHEHTSGYYRVSCYFFGKLLADLIPRRLLPSTIVLITYFIAG
GRMSMSSFFAMLFTVMMLDFSVSSLPLSIGAGKNAVAVPTLFVTIYFVFMLIFSGLSLYS
GSLPPKLSWIQYFSILHYAFKALLHNEFLGQNFCSEDRMEELSRCHNYVICAGEEFLAIQ
GIDLSSWGFWENHLALACIMIILLTITYVQLLQVKTLEVLRSRGRNFLQLFN
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccagtaatgaccccactgtaataccaatgacagaaagacgtcacagtgacctt
cccgaaacaaacaccagtgacccggagacactgactggagaggctgttgtgttgagtttt
cacaacatcagctacatagaaacagtgcagagcggctttccactttgtcagaagacacgt
gtgatggaaagactgtcgagcatcagtgggatcatgggaccaggcctcaatgccataatg
ggacctcaggatgggagcagatctctgttattagatgtcttagctgcaaggagacatcca
agtggattatcaggagatattttggtaaacggtaaacctcgacctgctaatttcaaatgt
acatctggttatgtaccacataatgatgtggtcatgcacacagtgaccgtgagagacaat
ttagagttctcagcagctctctgtcttccaatgactataacaagagatgaaaaaagaagg
aggatcaatgaggtgcttgaacttcttcatctggatgaaaaacaaaataccaagcctaga
tccaaagaactcaggaaaaggaccagtatagcagtggagctgatcgctgaccatcccatt
ttgttcttggataatcccaccacttacttagactttacaactacgacttatgtcatatca
gtcctgagaaggatgtcgatgaagggaaagacaatcatcttctccatcaatcagcctcag
tactccatcttcagattctttgatagcctcaccttaatggcttcaggaaaactcatgttt
catggacctgcacgggatgctctggagtacttcacatctgcgggttaccctgcagacttc
ttcctggacatcattaatggaggtttctgtgacacagaggaagatggccatgaagttgga
aactatgaagaactttttgagagacaatatcaagccacaaaaaaattggtcaatatgtat
gcccagtcccgcttacacagtgacacaagagccagactggatcaaatcttggggcaacag
cagctggacaggaactcagctgtggagaccacatgtgccacccctttctggcatcaactc
atgtggattacctatcgatcattcaaaaatatctggggttttccatgggccactgtgatt
caggctgttatcatagccatactggcagcactgataggcatcgctttccaggtcctgaaa
aatgattgtaatgaagtccggataagagccggcctcctttacctgctcacaatcttccag
agcctcacaagtgtgtttgcaggggtgctctttgtgattaacaggcatcgctttctacat
gagcacaccagtggatactacagagtgtcatgctatttctttgggaaattgctggctgac
ctaatacccaggaggctgttgccaagtactatagtactcataacatacttcatagcagga
ggaagaatgagcatgagctctttctttgctatgctatttaccgtcatgatgctggatttt
tctgtcagctccctgccactgtctataggagccgggaagaatgcagtggctgttccaaca
ctgtttgtgaccatctactttgtgttcatgctgatcttttcaggtttatcactatattcc
ggaagcctcccacctaagctctcatggattcaatactttagcattcttcattacgccttt
aaggctttgctgcacaatgagttcctcggacaaaacttctgttcagaagacaggatggaa
gaactcagtagatgccataactatgtaatatgtgctggtgaagaattcttggcgatccag
ggcatcgatctctcatcgtggggcttctgggagaatcacctggctttagcttgtataatg
attatcctcttaacaattacctatgtgcagttattacaggttaagacattagaagttctt
agatcgcgggggaggaattttcttcagttgtttaactaa

DBGET integrated database retrieval system