KEGG   Rattus norvegicus (rat): 361035
Entry
361035            CDS       T01003                                 

Gene name
Mettl3
Definition
(RefSeq) methyltransferase-like 3
  KO
K05925  mRNA m6A methyltransferase catalytic subunit [EC:2.1.1.348]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    361035 (Mettl3)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     361035 (Mettl3)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     361035 (Mettl3)
SSDB
Motif
Pfam: MT-A70
Other DBs
NCBI-GeneID: 361035
NCBI-ProteinID: NP_001019965
RGD: 1311750
Ensembl: ENSRNOG00000013111
UniProt: Q4V8G6
Position
15p14
AA seq 580 aa
MSDTWSSIQAHKKQLDSLRERLQRRRKQDSGHLDLRNPEAALSPTFRSDSPVPTAPTSSG
PKPSTTSIVPELATDPELEKKLLHHLSDLALTLPTDAVSIRLAISTPDAPATQDGVESLL
QKFAAQELIEVKRGLLQDDAHPTLVTYADHSKLSAMMGAVAEKKGLGEAAGTITGQKRRA
EQDLTTVATFTSSLASGLGSSTSEPAKEPAKKSRKHAASDVDLEIESLLNQQSTKEQQSK
KVSQEILELLNTTTAKEQSIVEKFRSRGRAQVQEFCDYGTKEECMKASDADRPCRKLHFR
RIINKHTDESLGDCSFLNTCFHMDTCKYVHYEIDACVDSESPGSKEHMPSQELALTQSVG
GDSSADRLFPPQWICCDIRYLDVSILGKFAVVMADPPWDIHMELPYGTLTDDEMRRLNIP
VLQDDGFLFLWVTGRAMELGRECLNLWGYERVDEIIWVKTNQLQRIIRTGRTGHWLNHGK
EHCLVGVKGNPQGFNQGLDCDVIVAEVRSTSHKPDEIYGMIERLSPGTRKIELFGRPHNV
QPNWITLGNQLDGIHLLDPDVVARFKHRYPDGVISKPKNL
NT seq 1743 nt   +upstreamnt  +downstreamnt
atgtcggacacgtggagctctatccaggcccataagaaacaactggactcgcttcgcgag
agactgcagcggcggcggaagcaggactctgggcacttggacttaaggaatccagaagca
gcactgtccccaaccttccgtagtgatagcccagtgcctactgcccctacctctagtggc
cctaagcccagcacaacgtctatagtccctgaattagctacagaccctgagttagagaag
aagttgctacaccacctctcagatctcgccttaaccttgcccactgatgctgtatccatc
cgtcttgccatctctacgccagatgcacctgccactcaagatggggtagaaagccttcta
cagaaatttgctgcccaggagttgattgaggtaaagcgaggtctcctacaagatgacgca
catcccactctcgtaacctatgctgaccactccaagctgtctgccatgatgggggctgtg
gcagaaaagaaaggccttggagaggcagcagggactatcacagggcagaaacggcgtgca
gagcaggacttgactacagtggctacctttaccagctctttagcatctggtctgggctct
tcaacatcagaaccagctaaggagccagctaagaaatcaaggaagcacgctgcctcagat
gttgacctggagatagaaagtcttttgaaccaacagtcaactaaggaacagcagagcaag
aaggtcagtcaggagatcctagagctattaaataccacaacagccaaggaacagtccatt
gttgaaaagttccgctctcgaggtcgggcccaggtgcaagaattttgtgactatgggacc
aaggaagagtgcatgaaagccagtgacgctgatcggccttgtcgcaagctgcacttcaga
cggattatcaacaagcacactgatgagtctttaggtgattgctctttcctgaacacctgc
ttccacatggacacctgcaagtatgtccactatgaaattgacgcctgtgtggattctgag
agtcctggcagcaaggagcacatgccgagccaggagcttgctcttacacagagcgttggg
ggcgactccagtgcagaccgactctttccaccccagtggatctgttgtgatatccgctac
ctggacgtcagtatcttgggcaaatttgcagttgtgatggctgacccaccttgggatatt
cacatggagctaccgtatgggacgttaacagatgacgagatgcgcaggctcaatatacca
gtactacaggatgatggctttcttttcctctgggtcacaggcagggccatggaattgggc
agagaatgtctgaacctctggggttacgagcgggtggacgagatcatctgggtgaagacc
aatcagctgcagcgcatcatcaggacaggccggacaggccactggctgaaccacgggaag
gagcactgcttggttggtgtcaaaggaaatccccaaggcttcaaccagggtctggattgc
gatgtgattgtagctgaggttcgttccaccagtcacaaaccagatgaaatatatggcatg
attgagagactgtcccctggcacccgaaagattgagttatttggacgaccacacaatgtg
cagcccaactggattactcttggaaaccaactggatgggatacaccttctggacccagat
gtggttgcccggtttaagcacaggtatccagatggtgtcatctctaaacctaagaactta
tag

DBGET integrated database retrieval system