KEGG   Rattus norvegicus (rat): 361063
Entry
361063            CDS       T01003                                 

Gene name
Entpd4
Definition
(RefSeq) ectonucleoside triphosphate diphosphohydrolase 4
  KO
K12305  ectonucleoside triphosphate diphosphohydrolase 4 [EC:3.6.1.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00240  Pyrimidine metabolism
rno01100  Metabolic pathways
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    361063 (Entpd4)
   00240 Pyrimidine metabolism
    361063 (Entpd4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    361063 (Entpd4)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.6  nucleoside diphosphate phosphatase
     361063 (Entpd4)
SSDB
Motif
Pfam: GDA1_CD39 DUF5894
Other DBs
NCBI-GeneID: 361063
NCBI-ProteinID: NP_001101854
RGD: 1309511
Ensembl: ENSRNOG00000016321
UniProt: D3ZZW3
Position
15
AA seq 362 aa
MGSISPVGCPRILNTNLRQIVVISILAAAVSLLYFSVVIIRSKYGWLSKDKKFQRYLARV
TDVEATDTNNPNVNYGIVVDCGSSGSRIFVYCWPQHNGNPHDLLDIRQMRDKNRKPVVMK
IKPDEIQQNGQTLYLRGTGDFDLCRETLQPFMNKTNETQTSLNGVYQPPIHFQNSEFYGF
SEFYYCTEDVLRMGGDYNAAKFTKAAKDYCATKWSILRERFDRGLYASHADLHRLKYQCF
KSAWMFEVFHRGFSFPVTYKSLKTALQVYDKEVQWTLGAILYRTRFLPLRDIRQEVFRAG
HAHWQGVSFVYNHYLFSGCFLVVLLSILLYLLRLRRIHRRAPRTGSLWMEEGLPSQKGPG
PL
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggggagcatctcgccagtgggctgtcctcgaattctgaacaccaatttacgacaaatc
gttgtcattagcatcctggctgcagctgtctcccttttatacttttctgttgtcataatc
cgcagcaagtatgggtggctgtcaaaggacaagaaatttcaaaggtacttggcccgagtc
acagacgttgaggctacagacaccaacaaccccaacgtgaactatggcattgtggtggac
tgcggcagtagtgggtctcggatatttgtctattgctggcctcagcacaacggcaatcct
catgacctgctggacatcagacagatgagggacaaaaaccggaagccagtggtgatgaaa
attaagcccgatgagatccagcaaaatgggcaaaccctgtaccttcgggggacaggagac
ttcgacctgtgtcgagagaccctccagcctttcatgaacaaaaccaatgagacacagact
tctctcaatggagtctaccagcctccaatccacttccagaacagtgaattctatggcttc
tctgagttctactattgcaccgaagatgtcttacgaatggggggagactacaatgctgct
aaatttactaaagctgccaaggattactgtgcaacaaagtggtcgatcttgcgggaacgc
tttgaccgaggactgtacgcctctcatgccgacctccatcgacttaagtatcagtgtttc
aaatcagcctggatgtttgaggtgttccacaggggcttctccttccctgtcacatacaaa
agtctgaagacagccttgcaggtgtatgacaaggaagtgcagtggaccctgggggcaatc
ctttacaggacccgctttctgcccttgagagacatccgacaggaggtgttccgggctggc
catgcacactggcagggcgtgtcctttgtctacaaccactatctgttctctggttgcttc
ctggtcgtccttctatccatccttctctacctgctgcggcttcggcgcatccaccgcagg
gcaccccgcactggctctctgtggatggaggaaggcctgccctcccagaagggccctggg
cccttgtga

DBGET integrated database retrieval system