KEGG   Rattus norvegicus (rat): 361071
Entry
361071            CDS       T01003                                 

Gene name
Sucla2
Definition
(RefSeq) succinate-CoA ligase ADP-forming beta subunit
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00020  Citrate cycle (TCA cycle)
rno00640  Propanoate metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
Module
rno_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rno_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    361071 (Sucla2)
   00640 Propanoate metabolism
    361071 (Sucla2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    361071 (Sucla2)
Enzymes [BR:rno01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     361071 (Sucla2)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     361071 (Sucla2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   361071 (Sucla2)
SSDB
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 DUF3947 GARS_A
Other DBs
NCBI-GeneID: 361071
NCBI-ProteinID: NP_001101857
RGD: 1309397
Ensembl: ENSRNOG00000017481
UniProt: F1LM47
Position
15q11
AA seq 465 aa
MAASMFFGRQLAAAALRSHRSQTTVRATAQALGSSGLFNKHGFQMQQQQQQQRSLSLHEY
LSMELLQEAGVSVPKGFVAKSSDEAYAIAKKLGSKDVVIKAQVLAGGRGKGTFTSGLKGG
VKIVFSPEEAKAVSSQMIGQKLITKQTGAKGRICNQVLVCERKYPRREYYFAITMERSFQ
GPVLIGSSQGGVNIEDVAAENPEAIVKEPVDIIEGVKKEQAVTLAKKMGFPSNIVDSAAE
NMIKLYNLFLKYDATMVEINPMVEDADGKVLCMDAKINFDSNSAYRQKKIFALQDWSQED
ERDKDAADADINYIGLDGNIGCLVNGAGLAMATMDIIKLHGGTPANFLDVGGGATVHQVT
EAFKLITSDKRVQAILVNIFGGIMRCDIIAQGIVMAVKDLEIRIPVVVRLQGTRVDDAKA
LIADSGLKILACDDLDEAAKMVVKLSEIVTLAKEAHVDVKFQLPI
NT seq 1398 nt   +upstreamnt  +downstreamnt
atggcggcgtccatgttcttcggccggcagttggccgcggccgccctgaggagccaccgg
tcgcagactacagtgcgagccacggcccaggctctgggaagttctggattgtttaacaag
catggattccaaatgcagcagcagcagcagcagcagaggagtctctcactgcatgaatac
ttgagtatggaattactgcaagaagcgggcgtctctgtccccaaaggcttcgttgcaaag
tcatcagatgaagcttatgcaatcgccaaaaagctagggtcaaaggatgttgtgataaag
gcacaggttttagctggcggcagaggaaaaggaacgtttacaagtggcctcaaaggagga
gtgaagattgttttctctccagaagaagcaaaagctgtttcctcacagatgattgggcaa
aaattgattaccaagcaaactggagcaaagggcagaatatgcaatcaagttttggtctgt
gagcgaaaatatcccaggagagaatactactttgcaataacaatggagaggtcatttcaa
ggccctgtactgataggaagttcacaaggtggggttaacattgaagatgttgctgctgag
aatcctgaagccattgtaaaggagcctgttgatataattgaaggcgtcaaaaaggaacaa
gctgtgacacttgcaaagaagatgggatttccttctaacattgtggactctgcagcagaa
aacatgatcaagctttataacctttttctgaagtatgacgcaactatggtagaaataaac
ccaatggtagaagatgctgatggaaaggtgttgtgcatggatgcaaagatcaattttgat
tcaaattcagcctatcgccagaagaagatctttgctcttcaggactggagccaggaggac
gagagggacaaagacgcagctgatgcagatattaactatattggcctcgacgggaacata
ggatgtctagtaaatggtgctggcttggctatggccacaatggatataataaagctacac
ggagggactccagccaacttccttgatgttggtggaggcgccacagtccatcaagtaaca
gaagcatttaaactgatcacttcagataaaagggtgcaggctattctggtcaacatcttt
ggaggaatcatgagatgtgatattattgcacaaggaatagtcatggcagtaaaagatcta
gaaattagaatacctgttgtggtacggttacaaggtacacgagttgatgatgctaaggca
ctaattgcagacagtggtcttaaaattcttgcttgcgatgatttggatgaagctgctaaa
atggttgtaaagctctctgaaatcgtgaccttagccaaagaagcccacgtggatgtgaag
tttcagttgccaatatga

DBGET integrated database retrieval system