KEGG   Rattus norvegicus (rat): 361073Help
Entry
361073            CDS       T01003                                 

Gene name
Cog3
Definition
(RefSeq) component of oligomeric golgi complex 3
  KO
K20290  conserved oligomeric Golgi complex subunit 3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    361073 (Cog3)
Membrane trafficking [BR:rno04131]
 Endosome - Golgi transport
  Tethering complex
   Conserved oligomeric Golgi (COG) complex
    361073 (Cog3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec34 APG17 Laminin_I EzrA
Motif
Other DBs
NCBI-GeneID: 361073
NCBI-ProteinID: NP_001012157
RGD: 1304555
Ensembl: ENSRNOG00000000155
UniProt: Q5XHZ8
Position
15q11
AA seq 828 aa AA seqDB search
MAEASLLLLPEAAAERDAREKLSLWDRRPDSIAPLTDRQTDSVLELKAAVENLPVPAELP
IEDVCSLASQSLPIELTAVVPESTEDVLLKGFTSLGMEEERIETAQQFFSWFAKLQTQMD
QDEGTKYRQMRDYLSGFQEQCDAILSDVNSALQHLESLQKQYLFVSNKTGTLHEACEQLL
KEQSELADLAEHIQQKLSYFNELETINTKLNSPTLSVNSEGFIPMLAKLDDCITYISSHP
NFKDYPVYLLKFKQCLSKALHLMKTYTVNTLQTLTNQLLKRDPSSVPNADNAFTLFYVKF
RAAAPKVRTLIEQIEQRSEKIPEYQHLLNDIHQCYLDQRELLLGPSIAYTVTELTSQNNR
DHCALVRSGCAFMVHVCQDEHQLYNEFFTKPTSKLDELLEKLCVSLYDVFRPLIIHVIHL
ETLSELCGILKNEVLEDHVQNNAEQLGAFAAGVKQMLEDVQERLVYRTHIYIQTDITGYK
PAPGDLAYPDKLVMMEQIAQSLKDEQKKTPSEASFSDVRLEEGESSSLRKSGSTDSLNPR
PQTTISPADLHGMWYPTVRRTLVCLSKLYRCIDRAVFQGLSQEALSACIQSLLGASESIS
KNKTQIDGQLFLIKHLLILREQIAPFHTEFTIKEISLDLKKTRDAAFKILNPMTVPRFFR
LNSNNALIEFLLEGTPEIREHYLDSKKDVDRHLKSACEQFIQQQTRLFVEPLEEFMTKVS
ALKTMASQGGPKYTLSQQPWAQPAKVNDLVATAYKTIKTKLPQTLRSMSLYLSNKDTEFI
LFKPVRNNIQQVFQKFHALLKEEFSPEDIQIIACPSVEQLNLLLSVSK
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggcgtcgctgctgctgctgcccgaggcggcggccgagcgggacgcccgcgag
aagctgtctctctgggatcggagacccgactcgatagcgccgctgacagacaggcagacg
gactcggtgctggagctaaaggcggcagtggagaacctgccggtgccggccgagctccca
attgaagatgtatgcagtttagcatcccagtcgctgcccattgagctgactgctgtagtg
cctgaatctacagaagacgtcctcttaaagggcttcacatctttaggaatggaagaagaa
agaattgagactgcacagcagtttttctcatggtttgcaaagctgcaaactcaaatggat
caggatgaaggaactaaatatagacagatgagggattacttgtctgggtttcaggaacag
tgtgatgctatactgagtgacgtgaacagtgctcttcagcacctggagtccctgcagaaa
cagtatctgtttgtgtccaacaagacaggaacacttcacgaagcctgtgaacagctccta
aaagagcagtcggaacttgctgatcttgctgagcacatccaacagaagctgtcttatttt
aatgagttggagaccattaacacaaaattgaattccccaacgttgtctgtgaatagtgaa
ggatttatccctatgctggccaagttagatgattgtataacatatatttcatctcatcct
aattttaaagattatcctgtatacttactgaagtttaaacaatgtctttctaaagctttg
cacctcatgaagacatatactgtgaacacactgcagactctcacaaatcagttactaaaa
agggacccctcatcagtccctaatgcagacaatgccttcacactattttatgtgaaattt
cgagctgctgcccctaaagtcagaactctcattgaacaaatagagcaacgttctgagaag
atacccgaataccagcacctgctcaatgatatccaccagtgttaccttgatcagcgggag
ctccttttgggcccaagtattgcctacactgtcacggagctaaccagccagaacaacaga
gaccattgtgccttggttcgcagtggctgtgcctttatggtccatgtctgccaagatgag
caccaactttacaatgaattttttacaaagccaacatcaaaattagacgaactgttggag
aaactgtgcgtgtcactgtatgacgtgttccggccgttgatcatccacgtcattcaccta
gagactctgtctgagctctgtgggattcttaaaaatgaggtgcttgaagaccatgtacag
aacaacgctgaacagctgggggcctttgcagctggagtaaagcagatgttggaagatgta
caagagaggcttgtgtatcgcacccatatctacattcagacggacatcacaggctataaa
ccagctcctggagacctggcgtaccctgataagcttgtcatgatggagcaaattgcacag
agtttaaaggatgaacagaagaagacaccttcagaagcttccttttcagatgtacggtta
gaagaaggagagtccagtagtttaagaaagtctggttcaacagactccctcaatcctaga
ccacagaccacgatttctccagcagatcttcacgggatgtggtatcccacagttcgaagg
acacttgtctgtctctccaaattatatagatgcatagatagggcggtgttccaaggatta
tcacaggaagccttgtctgcttgcatacagtccttgctaggagcatcagagtctatcagc
aaaaacaagactcagattgatggacaacttttcttaattaagcaccttttgattcttcga
gaacaaattgctccatttcacactgaattcaccattaaggaaatttccctggacctcaag
aaaactcgagatgcagcatttaaaatcctgaaccctatgactgttccgagattttttagg
ctgaatagcaacaatgccttgatagagttcttgttggagggaactcctgagatcagagag
cattatcttgactctaagaaggacgtggatcggcacctgaagtcagcctgtgagcagttc
attcagcaacagaccaggctatttgtagagccactggaggagttcatgacaaaggtatca
gcattaaaaaccatggccagtcagggaggccccaagtacaccctctcacagcagccttgg
gcacaaccagcgaaggtcaacgaccttgtggccactgcttacaagacaataaaaacgaag
ctgccgcagacattgagaagcatgtctctgtacttgtccaataaggacacggagttcatc
ttgtttaagcctgtcaggaataacattcagcaagtcttccagaagttccatgctctgcta
aaggaagagttcagtcctgaagatatccagattattgcttgtccttctgtggaacagcta
aacctcctgctgtcagtctctaagtag

DBGET integrated database retrieval system