KEGG   Rattus norvegicus (rat): 361084Help
Entry
361084            CDS       T01003                                 

Gene name
Lmo7
Definition
(RefSeq) LIM domain 7
  KO
K06084  F-box protein 20
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    361084 (Lmo7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    361084 (Lmo7)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     361084 (Lmo7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4757 CH LIM PDZ PDZ_2 PDZ_6 CAMSAP_CH
Motif
Other DBs
NCBI-GeneID: 361084
NCBI-ProteinID: NP_001001515
RGD: 1302984
Ensembl: ENSRNOG00000060775
UniProt: Q6JBI7
Position
15q21
AA seq 1729 aa AA seqDB search
MEGMEDAEADCSIAFAEAQRWVEAVTEKNFETRDFRASLENGVLLCDLINKLKPGVVRKI
NRLSTPIAGLDNINVFLKACEQIGLKEAQLFHPGDLQDLSNRVTVKQEETDRRLKNVLIT
LYWLGRKAQNNPYYHGPYLNLKAFETLLGQALTKALEDSSCLKRSGRDSGYGDIWCPDRG
DFPAPPGSHRREDSFESLDSLGSRSLTSCSSDLTLRGGREGCESDNDWEFTFKMQDYNKD
DMSYRRISAIEPKSALPFNRFLPNKSKQPSYVPAPLRKKRPDKNEDNRRSWASPVYTETE
GTFSSTQRRAWGPKMENWHTVQETSTSSWCLEEEEEKVTRLPNVVKDDLYVRKLSPVMPS
PGSSFDQFLPKGWTPEDMNWKKIKRETYKPWYKEFQGLSQFLLLQALQTYSDDILSSETN
VKLDPTSGPRLITRRKNFSPTPGYRAHDLEPQSLDPDLENDDFFVRKTRAFHANPCVLRA
FEDFRRFSEPDDAVERDIILQCREGELVLPDLEKDDMIVRRIPAQKKEVPLSGAPDRYQP
VPFPEPWTLPPEIQAKFLSVLERTCPPKDKPSSCRVLVPSHRLKKDDMLTRKIQSWKLGT
AVPPISFRPGPCSEADLRKWEAIREASRLRHRKRLMVERLFQKIYGENGSKSLSDVSAED
VQSLRQLRYEEMQKIKSQLKEQDQKWQDDLAKWKDRRKSYTSDLQKKKEEREEIEKQALE
KSDRSSKTFREMLQDRESQSSTTTSRRRIYSSDDILDDGVLPPTVTLSETSYQSERLEDK
ARAHPAEMPKEDSTTFASREDGIAAEIPLASHIPEERRQAPWPSAETRQASSSSAESHQA
SLPSTESDQARLPSAEPHQASFSSAEPRQVPLVSAEPHQASSFSSTEPHQASLSSALQRP
SSLSSSQQSWSTRGESTRISASLPRSYQRSDTARLTSVVTARPFGTSSRGISSLPRSYTM
DDGWIYNGDVEVVKREQHDSGRAAGMKPDSSHFILGSSSEKEVATGEDGASLSSFVLPSS
SSLSHDQAASSKATFSSTSGLDSVSDSGEGRSSSLREVSRSPDQFSDMRISINQTPGTKH
DFGFTIKWDVSGISVASVEKGSPAEFSQLQVDDEILAINNTKFSYKDTKKWEEAMANAQE
TGNLVMDVRRYGKSGSPETKWIDTTSGIYSTEKSSSLSVTTDFSESLQSPYSESKEINGI
HEGSNAFDSKASESISLKNLKRRSQFFEQGSSDSVAPDLPVPTLSAPSRWAWDQEEERRR
QERWQKEQDRLLQEKYQREQEKLREEWQRAQQEAERENSKYLDEELMVLNSNSISLTSRE
SVTASWEPSWSEGSKSLDREGTRAGDEDRGQLEDDAVYEDQSQKLQERLMLEHEKKRKEQ
EAQEEELRKQREAEAQARAEAEAQARAEAQARAEAQAQAEAEARKRAEAQKLQAERERET
SVKIYQYRRPIDSYDLPKREEESSGLLPIDRSKSRSTTELNDPLIEKSGSSKYSDRIGTT
SFSQRSSKKDQGPSEAELERQQILQEMRKKTSLHNDNSWIRQRSASVNKEPICLTGIMRR
GESLDNLDSQRPGSWRQSSWHSQPAGVYASSSVQDFSRLPPQLLSTSNRAYMRNPSSAVP
PLAGSVKTSPGSPSPRSHSPSMSQSGSQLRNRSVSGKRVCSYCNSILGKGAAMIIETLGL
CYHLHCFKCVSCERDLGGSSSGAEVRIRNHQLYCNDCYLRFKSGRPTAM
NT seq 5190 nt NT seq  +upstreamnt  +downstreamnt
atggaagggatggaggacgctgaggccgattgctccattgcattcgcggaggctcagaga
tgggtggaggctgtaactgagaagaattttgaaacaagggattttcgagcctctctggaa
aatggtgttctgttgtgtgatttgattaataagctcaaacccggagtcgttaggaagatc
aatagactgtcgaccccgatagcaggtttggataacataaacgtttttttgaaagcttgt
gaacagattggattgaaagaagcccagctttttcatcccggggatctacaggatttatca
aaccgagtcactgtcaagcaagaagagactgacaggagactgaaaaatgttttgataact
ttatactggctgggaagaaaagcacaaaacaacccctactatcatggtccctatctcaat
ttgaaggcttttgagactcttttaggacaagctttgactaaggcacttgaagattctagc
tgcctgaagagaagtggccgggacagtggctacggggatatctggtgtccggacagagga
gactttcctgcccctcccgggagccacaggagggaagattcctttgaaagcttggactcc
ttggggtctagatcactgaccagctgctcctcagacctcactctcagaggcgggagggaa
ggttgcgaaagtgacaacgattgggaattcaccttcaaaatgcaggattataacaaagat
gacatgtcctaccgacggatttcggccattgaaccgaagtcagctctaccattcaatcgc
ttcttgcctaacaaaagcaagcagccatcctatgtgccagcgcctttgaggaagaagagg
ccagacaaaaatgaggataatagaagaagctgggctagccctgtctacacagaaacagag
ggaacattttcaagtacccagaggagagcttggggtcccaagatggagaactggcacaca
gtccaagaaacttccacctcctcttggtgtttagaagaggaagaagaaaaagtcacacgc
ttgcccaatgttgtgaaggacgatctctatgtgcggaagcttagcccagtcatgcccagc
ccagggagttctttcgatcagttccttcccaaaggctggacccctgaagatatgaactgg
aaaaaaataaaaagagagacttataagccatggtataaggaatttcagggactcagtcag
tttttattgcttcaggccctccaaacctactctgatgatatcttgtcttcggagacaaat
gtcaaactcgatcctacctctggcccgaggctcataactcgcaggaagaacttttctccc
accccaggctaccgagcccacgacctcgagccgcaatccctagatcctgacttagaaaat
gacgatttctttgtcagaaaaacgagggctttccatgccaatccgtgtgttcttcgagcc
ttcgaagactttagacggttctccgagccggacgacgctgtcgaacgcgatataattttg
cagtgtcgggaaggtgaactcgtacttccggatttagaaaaggatgacatgattgttcgc
aggatcccagctcagaagaaagaagtgcccctttctggggcgccagatagataccagcca
gtccccttccctgaaccgtggactctacctccagaaatccaagcgaaatttctctcggtg
cttgaaaggacatgcccacccaaagacaaaccaagtagctgtagggtgttagtaccttcc
catcgactgaagaaagacgacatgttgactcgcaagatccagtcttggaagctggggact
gctgtgccacccatcagcttcaggcctggcccctgcagcgaggccgacctacggaagtgg
gaggccatccgggaggccagcagacttaggcacaggaagcggctgatggttgagagactc
tttcaaaagatttatggtgagaacgggagcaagtccctgagcgatgtcagcgcagaggat
gttcagagcctgcgtcagctgcgctacgaggagatgcagaaaataaaatcccagttgaag
gagcaagatcagaaatggcaggatgaccttgcgaaatggaaagatcgccggaagagttac
acttcagacctgcagaagaaaaaggaggagagggaagaaattgaaaagcaggcccttgag
aagtctgatcgaagctccaagacattcagggaaatgctgcaggacagggaatctcaaagt
tctacaactacatctagaaggaggatctattcctctgatgacatcctggatgatggcgtg
ctccctcctacagtgactctgtcagaaactagttaccagagcgagaggctagaagacaag
gcaagagctcatcctgctgagatgcccaaggaagattccacaacatttgcaagtagagag
gacggtatagcagccgagatcccgcttgcttctcatattcctgaagagcgacgtcaggcc
ccttggccttctgcagaaacacgccaggcctcttcatcttccgcagaatcgcaccaggcc
tccttgccttccacagaatcagaccaggcccggttgccatctgcagaaccgcaccaggcc
tctttctcttctgcagaacctcgccaggtccctttggtctctgcagaaccacaccaggcc
tcttctttctcctccacagaaccgcaccaggcctctttgtcttctgcactacagcgtcca
tcctcactctcttcttctcagcagtcatggagcacaagaggagagtcaactcggatttca
gcttctctccctagaagttaccagagaagtgatacagccaggctaacatctgtggtcaca
gcgagaccttttggcacatcgtcacggggaatctcatcactgcccagatcctacacgatg
gatgatggctggatatacaatggagatgttgaagttgtcaagagagagcaacatgattcg
ggcagagccgccggcatgaagcctgactccagccactttattttgggctcatctagtgag
aaggaggtagccacaggagaagatggggcaagcctgtcctctttcgtactcccttcttcc
tcatctctctcccacgaccaggcagcctcctcaaaagccacattctcatcaacgtctggc
ctggattcagtgtctgactctggagaagggagaagctcatcactgagggaagtttcaagg
tccccggatcagttcagcgatatgagaatcagcataaaccagacgcccgggaccaaacat
gactttggatttacaataaaatgggatgtttctgggatctctgtagcatcagttgaaaaa
ggtagcccagcagaattctctcagctgcaggtagatgatgaaattctcgccatcaataac
accaagttttcatataaggacacaaaaaagtgggaagaagctatggcaaatgcccaagaa
actggaaacttagtgatggatgtcaggcgctacggaaagtccggttcacccgaaacaaag
tggatcgatacaacttcaggaatttacagcacagagaagtcttcaagtctatcagtgaca
actgatttctctgaaagccttcaaagtccttattctgaatccaaagaaatcaatggaatt
catgaggggagcaacgcctttgattcaaaagcatcagaatccatttctttgaaaaattta
aaaaggcgatcacaattttttgaacaaggaagctctgattctgtggctcctgatcttccg
gttccaaccctcagtgccccgagtcgctgggcttgggatcaagaggaggagagacggcgg
caggagcggtggcagaaagagcaagatcgcctactgcaggaaaaataccaacgtgagcag
gagaagctgagggaagagtggcagagagctcagcaggaggcggagagagagaattccaag
tacctggatgaggagctgatggtcctaaattccaacagcatttccctgacctcccgggag
tctgtgactgcctcctgggaacccagctggagtgaagggtccaagtctctggacagggaa
ggcacccgagccggagatgaggaccggggacagctggaagacgatgctgtgtatgaggac
caaagtcagaagctgcaggaaaggctcatgcttgagcatgagaagaaaaggaaggagcaa
gaggctcaggaagaggagctccggaagcagcgggaagctgaggctcaagctcgggctgag
gcagaagcccaggccagggccgaggctcaggcccgggcagaggcccaggcccaggccgag
gctgaggctagaaaacgagctgaagcacagaagctccaggcagagagggaacgagaaact
tcggtcaaaatataccagtaccggaggcctattgattcctatgatctaccaaagagagaa
gaagaatcttcagggctgcttccaattgacaggagtaaatcaagatctactacagagctg
aacgaccccctcatagagaagagtggaagcagcaaatattcagatcgaattgggaccact
agcttttcacaaaggagttctaagaaggatcaaggcccctcggaagcggagttggagaga
cagcaaatccttcaggaaatgaggaagaaaacatctctccacaatgacaacagctggatc
cgacagcgcagtgccagtgtaaacaaggagcccatctgcctgactgggatcatgagaaga
ggggagtctctggacaatctggattcccagcggccaggatcttggaggcagtcctcctgg
cacagccagcctgcaggagtctacgcatcttcctctgttcaagactttagtcgcctgcca
ccacagctgttgtccacgtcaaaccgtgcctacatgcggaacccatcctctgcggtaccg
cctctagctggctcagtgaagacctccccggggtctccctctccacgtagccattctcct
tcgatgtcacagtcaggctctcagctacgtaacaggtcagtgagtgggaaacgtgtgtgc
tcctactgtaatagcattctgggcaaaggagccgccatgatcatcgagaccctgggtctt
tgttatcatttacattgttttaagtgtgtctcctgtgagcgtgacctcggaggctcttcc
tccggagccgaagtcagaatccgaaaccaccaactgtactgcaatgactgctatctccga
ttcaaatctggccggccaaccgccatgtga

DBGET integrated database retrieval system