KEGG   Rattus norvegicus (rat): 361102
Entry
361102            CDS       T01003                                 

Gene name
Polr3a, RGD1305574
Definition
(RefSeq) RNA polymerase III subunit A
  KO
K03018  DNA-directed RNA polymerase III subunit RPC1 [EC:2.7.7.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    361102 (Polr3a)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    361102 (Polr3a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    361102 (Polr3a)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     361102 (Polr3a)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Core subunits
     361102 (Polr3a)
SSDB
Motif
Pfam: RNA_pol_Rpb1_1 RNA_pol_Rpb1_5 RNA_pol_Rpb1_2 RNA_pol_Rpb1_3 RNA_pol_Rpb1_4
Other DBs
NCBI-GeneID: 361102
NCBI-ProteinID: XP_001056048
RGD: 1305574
Ensembl: ENSRNOG00000010008
UniProt: E9PTB6
Position
16p16
AA seq 1390 aa
MVKEQFRETDVAKKISHICFGMKSPEEMRQQAHIQVVSKNLYSQDNNHAPLLYGVLDHRM
GTSEKDRPCETCGKNLADCLGHYGYIDLELPCFHVGYFRAVIGILQMICKTCCHIMLSQE
EKQQFLDFLKRPGLTYLQKRGLKKKISDKCRKKSTCHYCGAFNGTVKKCGLLKIIHEKYK
TNKKVVDPIVSNFLQSFETAIEHNKEVEPLLGRAQENLNPLVVLNLFKRIPAEDVPLLLM
NPEAGKPSDLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLNDVIKKHRISG
AKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPKKWTRGFVQRLKGKQGRFRGNLSGKR
VDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNKANINFLRKLVRNGPDVHPGANF
IQQRHMQMKRFLKYGNREKMAQELKFGDIVERHLIDGDVVLFNRQPSLHKLSIMAHLAKV
KPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEALVLMGTKANLVTPRNGEPLIA
AIQDFLTGAYLLTLKDTFFDRAKACQIIASILVGKDEKIKVRLPPPTILKPVTLWTGKQI
FSVILRPSDDNPVRANLRTKGKQYCGKGEDLCTNDSYVTIQNSELMCGSMDKGTLGSGSK
NNIFYILLRDWGQNEAADAMSRLARLAPVYLSNRGFSIGIGDVTPGQGLLKAKYELLNAG
YKKCDEYIEALNTGKLQQQPGCTAEETLEALILKELSVIRDHAGSACLRELDKSNSPLTM
ALCGSKGSFINISQMIACVGQQAISGSRVPDGFENRSLPHFEKHSKLPAAKGFVANSFYS
GLTPTEFFFHTMAGREGLVDTAVKTAETGYMQRRLVKSLEDLCSQYDLTVRSSTGDIIQF
IYGGDGLDPAAMEGKDEPLEFKRVLDNIKAVYPCQSERALSKNELTLTTEAIMKKNEFLC
CQDSFLQEIKTFIKGVSEKIKKTRDKYGINDNGTTEPRVLYQLDRITRTQIEKFLETCRD
KYMRAQMEPGSAVGALCAQSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKAI
STPIITAQLDMDDDADYARLVKGRIEKTLLGEISEYIEEVFLPDDCFILVKLSLERIRLL
RLEVNAETVRYSICTSKLRVKPGDVAVHGEAVVCVTPRENSKSSMYYVLQFLKEDLPKVV
VQGIPEVSRAVIHIDEQSGKEKFKLLVEGDNLRAVMATHGVKGTRTTSNNTYEVEKTLGI
EAARTTIINEIQYTMVNHGMSIDRRHVMLLSDLMTYKGEVLGITRFGLAKMKESVLMLAS
FEKTADHLFDAAYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKANRDPKPPRRPLIFD
THEFHIPLVT
NT seq 4173 nt   +upstreamnt  +downstreamnt
atggtgaaggagcagttccgcgagacggatgtggctaagaaaataagccatatctgtttt
ggaatgaagtcccctgaggagatgcgccagcaggcacatatccaggttgtcagtaagaac
ctgtacagccaagacaacaaccatgcccccttgttgtatggagtgcttgaccatagaatg
gggacaagtgaaaaggatcgtccttgtgagacctgtgggaagaacctggcagactgtctg
ggccactatgggtacattgatctagagctgccgtgctttcatgtcgggtacttcagagct
gtcattggcattttacagatgatctgcaaaacctgctgccacattatgctgtcccaggaa
gagaagcagcagtttctagatttcctgaagaggcctggcctaacctacctgcagaagcga
ggcctgaagaagaagatctcagacaagtgccggaagaaaagcacttgtcactactgtggt
gcttttaatggtactgtaaagaaatgtggtttgctgaagataattcatgaaaaatacaag
acaaacaaaaaagttgtggatcccattgtatcaaacttcctgcagtcttttgagacagcc
attgagcataacaaagaggttgaaccactgctaggaagggcccaggagaacttgaatccc
ttagtagttctgaacttgtttaagcgcatcccagctgaagatgtcccgttacttctgatg
aacccagaagctggaaagccctctgatttgattctcacccgacttttggtgcctcccctg
tgtatcagaccttctgtcgtgagtgatttgaagtctggaaccaatgaagatgatctgaca
atgaaactgaccgagatcattttcctaaatgatgttattaaaaagcaccgcatctctgga
gccaagacacagatgatcatggaggactgggatttcctgcagctacagtgtgccctctat
atcaacagtgagctctctggcatccctctcaacatggcacctaagaagtggactcgaggc
tttgtccagcgtctgaaggggaagcagggtcgatttagaggtaatctgtcagggaagagg
gtggatttttctggccgaacagtcatctcacctgaccccaacctccgcattgatgaagta
gctgtgccagttcatgtggccaaaattctaacttttcctgagaaggtgaacaaagcaaac
atcaattttttgaggaaactggttcgaaatggcccagatgttcacccaggagccaatttt
atccaacagaggcacatgcagatgaaaaggttcctgaagtatgggaatcgggaaaagatg
gctcaggagctcaagttcggtgacattgtagagagacacctgatagatggagacgtggta
ttgttcaaccggcagccctcactgcacaaactgagcatcatggcccatctggccaaggtc
aagcctcatcgaaccttcagattcaatgaatgtgtctgcactccctacaatgcagacttc
gatggggatgaaatgaaccttcatcttccccagacagaggaagccaaagcagaggccctt
gttctcatggggaccaaagcgaaccttgtaaccccaagaaatggggagccactcattgct
gccattcaggacttcctaacaggtgcctacctcctcaccctcaaggacactttctttgat
cgagccaaggcttgccagatcattgcttcaatactggttggcaaagatgaaaaaattaaa
gtgcgcctcccaccccctacaatactaaagcctgtcaccctgtggaccggaaagcaaatc
ttcagtgtcatcctcaggcctagtgacgacaatccagtgagggccaaccttcgaaccaag
ggcaagcagtactgtggcaagggggaagacctctgcaccaacgattcctatgtcaccatc
cagaacagcgagttgatgtgcggcagcatggacaaagggactctggggtcggggtccaag
aacaacatcttctacatcttgcttcgagactgggggcagaacgaggctgccgatgccatg
tctcggcttgccaggctggctcctgtctacctgtctaaccgtgggttctccattgggatt
ggtgacgtcacgcctggccagggactgctgaaagccaagtatgagctactaaatgctggc
tacaaaaaatgtgacgaatacattgaagccctgaacacaggcaagctgcagcagcagcca
ggctgcactgctgaggagacactagaggctctgatcctgaaggagctgtctgtgatccgg
gaccatgctggcagtgcctgcctccgagagctggacaagagcaacagccctctcaccatg
gccctgtgtggttccaaaggttccttcattaacatatcacagatgattgcctgtgtggga
cagcaagccatcagtggctcccgtgttccagatggctttgagaacagatctttgcctcac
tttgagaagcattcaaagctccctgctgccaaaggctttgtggctaacagcttttactct
ggcttaacgcctactgaatttttcttccacacaatggctggtcgggagggtctggtggac
acagctgtaaagactgctgaaacaggatacatgcagagaagactggtcaaatccctggaa
gacctctgttcccagtatgatctgaccgttcggagttccaccggtgacatcatccagttc
atctatggaggggatggcttagatcctgccgccatggagggcaaagatgaaccactggag
tttaaaagagttctggacaacatcaaggcagtgtatccatgtcagagtgaacgtgctctc
agtaagaatgagctcaccttgaccactgaggccatcatgaagaagaacgagttcctgtgc
tgccaagacagcttcctgcaggaaataaaaacattcattaaaggggtgtctgagaagatt
aagaaaaccagagataaatacggcatcaatgacaacggcacaacagagcctcgtgtgctg
taccagttggaccgtattacccgtacccaaatagagaagtttctggagacctgtagggat
aagtacatgagggcacagatggagccaggctctgcagtgggtgcactctgtgcacagagc
attggtgagccgggcacccagatgaccctgaagactttccactttgcaggggtagcgtcc
atgaacatcaccctgggtgtgcctcggatcaaggagatcatcaatgcttccaaggccatc
agcactccaattatcacagcacagctagacatggatgacgatgcagattatgcacgcctg
gtgaagggcaggattgagaaaaccctcctgggggagatctcagagtacattgaagaagtg
tttcttcctgatgactgctttattcttgtcaagctgtccctggaacggatccgacttctg
agactggaggttaatgctgagacagtgcgctactccatctgcacatccaagctccgagtg
aagcctggcgatgtggcggttcatggggaggccgtggtgtgtgtcacccccagggaaaac
agcaagagctccatgtattatgtgctgcagtttctaaaagaggatctacccaaggtggtg
gtacagggcatcccagaggtgtcaagagcagtcatccacattgacgagcagagtgggaag
gagaagttcaagcttctagtagaaggtgacaacctgcgggcagtcatggccacccatggt
gtgaaaggcacgcgaaccacttctaataacacctatgaggtggaaaaaaccctgggtatt
gaggctgcgaggacaaccatcatcaatgagatccagtacacgatggtcaaccatggcatg
agcattgacaggaggcacgtgatgctgctctctgatctgatgacctacaagggtgaagta
ctgggtataaccaggtttggcctggccaagatgaaggagagtgtgttgatgctggcctcc
tttgagaagacagctgaccatctctttgatgctgcctactttgggcagaaggactccgtg
tgtggtgtgtctgagtgcatcatcatgggaatcccaatgaacattggaactggtctcttc
aaactgctacacaaagccaacagggacccaaaaccacccaggaggcccctgatatttgac
acacatgaattccacatccctcttgtcacatag

DBGET integrated database retrieval system