KEGG   Rattus norvegicus (rat): 361129
Entry
361129            CDS       T01003                                 

Gene name
Hapln4
Definition
(RefSeq) hyaluronan and proteoglycan link protein 4
  KO
K06853  hyaluronan and proteoglycan link protein 4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    361129 (Hapln4)
Glycosaminoglycan binding proteins [BR:rno00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   361129 (Hapln4)
SSDB
Motif
Pfam: Xlink V-set Ig_3 I-set ig Ig_2 Izumo-Ig
Other DBs
NCBI-GeneID: 361129
NCBI-ProteinID: NP_001101868
RGD: 1308408
Ensembl: ENSRNOG00000049949
UniProt: D3Z9H2
Position
16p14
AA seq 400 aa
MACAPGALGHRALWAVAWGLLLLVPVLAGAQRGRKKVVHVLEGESGSVVVQTAPGQVVSH
RGGTIVLPCRYHYEAAAHGHDGVRLKWTKVVDPLAFADVFVALGPQHRAFGPYRGRAELQ
NDGPGDASLVLRNVTLQDYGRYECEVTNELEDDAGMVKLDLEGVVFPYHPRGGRYKMTFA
EAQRACAEQDGILASAEQLHTAWRDGLDWCNAGWLRDGSVQYPVSQAREACGGSGSPGAG
GGTNGGVRNYGYRHNAEERYDAFCFTSNLPGRVFFLKPLRPVALAGAVRACAARGATVAK
VGQLFAAWKLQLLDRCTAGWLADGSARYPIVNPRTRCGGPRPGVRSLGFPDASRRLFGVY
CYRAPGAPDPAPGGWGWGWAGGGGWAGGSRDPAAWTPLRV
NT seq 1203 nt   +upstreamnt  +downstreamnt
atggcgtgtgctccaggagccctcggtcaccgcgcactctgggccgtggcctggggactc
ctgctgctggtccccgtgctcgcaggggcgcagcgtggcaggaagaaagtcgtgcacgtg
ctggagggcgagtccggttcggtggtggtgcagacggcgccggggcaggtggtgagccac
cgcggtggcaccattgtcttaccctgccgttaccactacgaggcggccgcccacggtcac
gacggcgttcgcctcaagtggacgaaagtagtagaccctttggctttcgccgatgtcttc
gtggctctgggtccccagcatcgagccttcggtccctaccgagggcgggccgagctacag
aacgatggacccggggacgcctccctggtcctccgaaatgtcaccctgcaggactacggg
cgctacgagtgcgaggtcaccaatgagttggaggatgacgccggcatggtaaagctggat
ctagaaggggtggtcttcccctatcacccgcgcggaggccgctacaagatgactttcgcg
gaagcccagcgcgcttgtgcggagcaggacggcattctggcatctgcggagcagctgcac
acggcctggcgcgatggcctggactggtgcaatgcagggtggctacgcgatggctccgtg
cagtacccggtgagccaggcccgagaggcctgtggcggatctgggagccctggggctggt
ggcggcaccaacgggggcgtgcgcaactatggatatcgtcacaacgccgaggaacgctac
gatgccttctgcttcacgtccaacctccccggccgcgtgtttttcctgaagccgctgcga
cctgtggccttggccggggccgtgcgtgcgtgtgcggcacggggtgccacagtggccaag
gtcgggcagctcttcgctgcgtggaagctgcagctcttggaccgctgcactgcgggctgg
ctggcggatggcagcgcgcgctaccccatcgtgaatccgcgaactcgctgcggaggtcct
cggcccggcgtgcgcagcctcggtttccctgacgcctcccgtcgcctcttcggtgtctac
tgctaccgcgctccgggtgccccagacccagctccaggcggctggggctggggctgggcc
ggcggaggaggttgggccggagggtcgagggatccggctgcctggaccccactgcgtgtc
tag

DBGET integrated database retrieval system